Conserved Protein Domain Family
KOG3859

?
KOG3859: KOG3859 
KOG3859, Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning]
Statistics
?
PSSM-Id: 231791
View PSSM: KOG3859
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152   1 MAATDLERFSNAEpePRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHEAC 80
gi 2507386    1 -MSVEVDFVDKKEvhLRTLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLFNTSFESTPSPHTLPS 79
gi 7304124    3 HLVTEKKTQEVATkvPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNLPN 82
gi 17564918  58 TAPSPIKSLSDHT--GRLMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKT 135
gi 30148280     --------------------------------------------------------------------------------
gi 29733176  43 VSAAQLNPWEKNN--IRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLIDTLFNTNLKDNKSSHFYSN 120
gi 20178343   1 MAATDIARQVGEG--CRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPG 78
gi 20178343   1 MAATDIARQVGEG--CRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPG 78
gi 20178343   1 MAATDIARQVGEG--CRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPG 78
gi 21945064  25 SQGSDDEQIKREN--IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPN 102
gi 22035581   1 MAATDIARQVGEG--CRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPG 78
gi 8922712    1 -MAVAVGRPSNEE--LRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPG 77
gi 30795193   1 -massevarhlkrenirsltmsghvgfeslpdqlvnrsiqqgfcfnilcvgetgigkstlidtlfntnfedyesshfcpn 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152  81 VRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRRSLFDYHDTRIHVCLYFITPT 160
gi 2507386   80 VKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSLVTCHDSRIHICLYFICPT 159
gi 7304124   83 VKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPT 162
gi 17564918 136 VELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPT 215
gi 30148280     --------------------------------------------------------------------------------
gi 29733176 121 VGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYLQEELKIKRSLFEYHDSRVHVCLYFISPT 200
gi 20178343  79 VQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPT 158
gi 20178343  79 VQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPT 158
gi 20178343  79 VQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPT 158
gi 21945064 103 VKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPT 182
gi 22035581  79 VQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPT 158
gi 8922712   78 VRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPT 157
gi 30795193  80 vklkaqtyelqesnvqlkltivntvgfgdqinkeesyqpivdyidaqfeaylqeelkikrslftyhdsrihvclyfispt 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152 161 GHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVV 240
gi 2507386  160 GHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQELNANGVHIYQFPTDDETVAETNTSMNSHIPFAVV 239
gi 7304124  163 GHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNVSIYQFPMDDETVSETNAAMNGHLPFAVV 242
gi 17564918 216 GHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTNKEMNKSVPFAVV 295
gi 30148280   1 ------MKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEK-RRLLEEEIIAFSKKKATSEIFHSQSFLAT 73
gi 29733176 201 GHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNKIMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVV 280
gi 20178343 159 GHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVI 238
gi 20178343 159 GHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVI 238
gi 20178343 159 GHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVI 238
gi 21945064 183 GHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVV 262
gi 22035581 159 GHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVI 238
gi 8922712  158 GHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVV 237
gi 30795193 160 ghslktldlltMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVV 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152 241 GSTEEVKVGN-KLVRARQYPWGVV-------------------------------------------------------- 263
gi 2507386  240 GSTEFIKVGN-KLIRARQYPWGTV-------------------------------------------------------- 262
gi 7304124  243 GSTEFVKVAG-KQVRARQYPWGAV-------------------------------------------------------- 265
gi 17564918 296 GSIDFVKKENgQMVRARQYPWGIV-------------------------------------------------------- 319
gi 30148280  74 GSNLRKD-------KDRKKEPG---------------------------------------------------------- 88
gi 29733176 281 GSTDEVK------VGKRMPPPNTmaprkgsswvaktnslgrwklasflkdfdckveirikpiesdrqnlfkevdklyniq 354
gi 20178343 239 GSTEELKIGN-KMMRARQYPWGTV-------------------------------------------------------- 261
gi 20178343 239 GSTEELKIGN-KMMRARQYPWGTV-------------------------------------------------------- 261
gi 20178343 239 GSTEELKIGN-KMMRARQYPWGTV-------------------------------------------------------- 261
gi 21945064 263 GSMDEVKVGN-KMVKARQYPWGVV-------------------------------------------------------- 285
gi 22035581 239 GSTEELKIGN-KMMRARQYPWGTV-------------------------------------------------------- 261
gi 8922712  238 GSTEEVKIGN-KMAKARQYPWGVV-------------------------------------------------------- 260
gi 30795193 240 GSMDEVKVGN-KMVKARQYPWGVV-------------------------------------------------------- 262
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152     --------------------------------------------------------------------------------
gi 2507386      --------------------------------------------------------------------------------
gi 7304124      --------------------------------------------------------------------------------
gi 17564918     --------------------------------------------------------------------------------
gi 30148280     --------------------------------------------------------------------------------
gi 29733176 355 ilrlpkalrkdewhewlnyfslggnkqgleeaatadlditagaiqtpltsaetrkviqvdemiveeeeeenkhknlqiat 434
gi 20178343     --------------------------------------------------------------------------------
gi 20178343     --------------------------------------------------------------------------------
gi 20178343     --------------------------------------------------------------------------------
gi 21945064     --------------------------------------------------------------------------------
gi 22035581     --------------------------------------------------------------------------------
gi 8922712      --------------------------------------------------------------------------------
gi 30795193     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152 264 ----------------------------------------------------------QVENENHCDFVKLREML-IRVN 284
gi 2507386  263 ----------------------------------------------------------QVENETHCDFVKLREML-IRTN 283
gi 7304124  266 ----------------------------------------------------------HIENEAHCDFVKLREML-IRTN 286
gi 17564918 320 ----------------------------------------------------------EVENESHCDFVKLREAL-LRTN 340
gi 30148280  89 -----------------------------------------------------------CRFELLCIDVRACETNgGRKD 109
gi 29733176 435 vkrcpasknrtqsvqgkgrrersscaitvtlvlglldvsivkptpgltprfdsrvfmipVENENHCDFVKLRDML-LCTN 513
gi 20178343 262 ----------------------------------------------------------QVENEAHCDFVKLREML-IRVN 282
gi 20178343 262 ----------------------------------------------------------QVENEAHCDFVKLREML-IRVN 282
gi 20178343 262 ----------------------------------------------------------QVENEAHCDFVKLREML-IRVN 282
gi 21945064 286 ----------------------------------------------------------QVENENHCDFVKLREML-ICTN 306
gi 22035581 262 ----------------------------------------------------------QVENEAHCDFVKLREML-IRVN 282
gi 8922712  261 ----------------------------------------------------------QVENENHCDFVKLREML-IRVN 281
gi 30795193 263 ----------------------------------------------------------QVENENHCDFVKLREML-ICTN 283
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18562152 285 MEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKER 364
gi 2507386  284 MEDMREKTHTRHYELYRQKRLEQMGFSDVDSDNKPISFQQTFEAKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEK 363
gi 7304124  287 MEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEK 366
gi 17564918 341 VDEMRQRTHESLYENYRRDRLRQM---KIGDGETGPKIIEKLAQKHREHQDEFSRRELTLREEFQKKLDVTEGDMRKVEE 417
gi 30148280 110 AEKGREGHSARGQP------------------------------------------------------------------ 123
gi 29733176 514 MENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEEELKQRFMQRVKEKEATFKEAEK 593
gi 20178343 283 MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEK 362
gi 20178343 283 MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEK 362
gi 20178343 283 MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEK 362
gi 21945064 307 MEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAER 386
gi 22035581 283 MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEK 362
gi 8922712  282 MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEK 361
gi 30795193 284 MEDLReqthtrhyelyrrckleemgftdvgpenkpvsvqetyeakrhefhgerqrkeeemkqmfvqrvkekeailkeaer 363
                       570       580       590       600
                ....*....|....*....|....*....|....*....|....
gi 18562152 365 ELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEAL 408
gi 2507386  364 DLHAKFEKLKRDHAEEKRKLEESRKALEEDYLDFQRRKQQLATA 407
gi 7304124  367 ELHTKFDRLKREHLEEKAQLEEARRQLEEDCQELQRRRLQMANG 410
gi 17564918 418 GLAAREREVHENYNREASKLDMEIRQLTEERMKLMTKVSKKLRK 461
gi 30148280     --------------------------------------------
gi 29733176 594 EVPY---------------------------------------- 597
gi 20178343 363 ELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELL 406
gi 20178343 363 ELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELL 406
gi 20178343 363 ELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELL 406
gi 21945064 387 ELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSEIF 430
gi 22035581 363 ELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELL 406
gi 8922712  362 ELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLL 405
gi 30795193 364 elqakfehlkrlhqeermkleekrrlleeeiiafskkkatseif 407
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap