Conserved Protein Domain Family
KOG3478

?
KOG3478: KOG3478 
KOG3478, Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 231416
View PSSM: KOG3478
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6016432    3 ELIQKKLQGEVEKYQQLQK---DLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKR 79  human
12230499   6 AALYKKMQAEIESYQNLQK---SCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEESRQNVGKR 82  fruit fly
25403096   7 RDLQRDLENKANDLGKIQKgkfHIGKNHQLRKKYTIQLGENELVLKELDLLEEDANVYKLIGPVLVKQDLAEANANVRKR 86  thale cress
1730034    1 MADMAKFEEEVNKLRTLEK---DREKYFTSRQEMEMRLTESKNVKAELDLMESDSKVYKLIGAVLVRQDLEEARSTVEKR 77  Caenorhabditis elegans
6016433    1 ------MEELAKKYQNLQT---ELSTYVESLKKLETQLQENTTVLNELEKVAPDSNIYKQIGPTLVKQSHEEAKTNVKTR 71  fission yeast
1730036    1 ------MSELGAKYQQLQN---ELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKR 71  baker's yeast
6016432   80 LDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAK 122 human
12230499  83 IEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVAAAMQ 125 fruit fly
25403096  87 IEYISAEL----------------------------------- 94  thale cress
1730034   78 LEFIDSETKRVEASISDISKKCTEQRDKVMNMQKSFQMMAQAA 120 Caenorhabditis elegans
6016433   72 LDFINKEIARLENQTKISQEEFSKVKGAIIQAQAAAAPPNPAS 114 fission yeast
1730036   72 LEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap