Conserved Protein Domain Family
KOG3361

?
KOG3361: KOG3361 
KOG3361, Iron binding protein involved in Fe-S cluster formation [Energy production and conversion]
Statistics
?
PSSM-Id: 231299
View PSSM: KOG3361
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19113879  23 SLLARPANLQFLKTNSSKFVPQVTANvs-rRMYHKNVLDHYNNPRNVGTLPKGDPDVGIGLVGAPACGDVMRLAIRVNK- 100 fission yeast
7299098    1 MSLVRNSSRLLRSQLKR---VQSVPV----ALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIKVDE- 72  fruit fly
15232028   2 MMLRQTSRKAYLGLQAS---PLGLGR----RLYHENVIDHFENPRNVGSFNRNDPNVGTGLVGAPACGDLMSLQIKVDD- 73  thale cress
15233385   1 -MLRQTTKRAFLGLASQNPTPFPVVS----RLYHPNVIDHYDNPRNVGSFDKNDPNVGTGLVGAPQCGDVMKLQVKFDG- 74  thale cress
15235569   1 MMLKQAAKK-ALGLTSRQSTPWSVGIl---RTYHENVIDHYDNPRNVGSFDKNDPNVGTGLVGAPACGDVMKLQIKVDEk 76  thale cress
17543474   1 MSLQISSAAKTLLHKFALPAATSVAQ------YHEKVIDHYENPRNVGSLDKNDPSVGTGIVGAPACGDVMKLQIRVDD- 73  Caenorhabditis elegans
19075060   1 MSALQELSG-------------ITGK------YDSSVVDHFENPRNVGSLDKTDPRVGTGMVGAPACGDVMKLQIKVGK- 60  Encephalitozoon cun...
24307953   1 MVLIDMSVDLS------------T-----------QVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDE- 56  human
6324800    1 -MFARLANPA--HFKPLTGSHITRAAk---RLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDk 74  baker's yeast
6325122    3 PVITRFARPALMAIRPVNAMGVLRASsitkRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDs 82  baker's yeast
19113879 101 DGVIEDVKFKTFGCGSAIASSSYVTTMVKGMTLEEASKIKNTQIAKELCLPPVKLHCSMLAEDAIKSAVKHYRSKQLTPV 180 fission yeast
7299098   73 NGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDAIKAALADYKVKQQKKV 152 fruit fly
15232028  74 SGQIIDTRFKTFGCGSAIASSSVASEWIKGKTLDEVMTIKNAEIAKHLRLPPVKLHCSMLAEDAIKSAVRDYKEKQAKTN 153 thale cress
15233385  75 SGQIIDAKFKTFGCGSAIAASSVATEWVKGKSVEEVLTIKNSQIAKHLSLPPVKLHCSMLAEDAIKAAIKNYKEKQDKAN 154 thale cress
15235569  77 TGQIVDARFKTFGCGSAIASSSVATEWVKGKAMEDVLTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYKEKRVKTN 156 thale cress
17543474  74 NGKIIEAKFKTFGCGSAIASSSLATEWINGKTIDYASKIKNDEIAKELCLPPVKLHCSMLAQDAIQAALKDYQKKQTKKA 153 Caenorhabditis elegans
19075060  61 DNVIEDAKFKTFGCGSAIASSSLATEWIKKKTIDESLKISNRDIAKKLSLPPIKLHCSMLAEDAIKMAIKDFLDKNKPSP 140 Encephalitozoon cun...
24307953  57 KGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKK 136 human
6324800   75 SGIIENVKFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKTKRN-PS 153 baker's yeast
6325122   83 TGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPT 162 baker's yeast
19113879 181 gTT 183 fission yeast
7299098  153 -AN 154 fruit fly
15232028 154 -AA 155 thale cress
15233385 155 -GE 156 thale cress
15235569 157 gAA 159 thale cress
17543474     ---     Caenorhabditis elegans
19075060     ---     Encephalitozoon cuniculi
24307953 137 -GE 138 human
6324800  154 vLH 156 baker's yeast
6325122  163 mLS 165 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap