Conserved Protein Domain Family
KOG3055

?
KOG3055: KOG3055 
KOG3055, Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 230993
View PSSM: KOG3055
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227607  38 VQLISAVQFRPCIDIHKGKVKQIVGSTLRDLkeDGSVLVTNFESDKSAEEYAKMYKEDGLTGGHVIMLGadPLSQAAAIG 117 thale cress
1723254    1 MEKSQHTLFRPCIDIHQGQVKQIVGGTLGN---DADV-KTNYVSLKPSSYYAELYKLNHLEGAHVIMLG--PNCEEAAKT 74  fission yeast
731787     1 -----MTKFIGCIDLHNGEVKQIVGGTLTSK--KEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIKLG--PNNDDAARE 71  baker's yeast
15227607 118 ALHAYPGGLQVGGGINSENCMSYIEEGASHVIVTSYVFN-NGKIDLERLKDIVSIVGKQRLILDLSCRK-KDGRYAIVTD 195 thale cress
1723254   75 ALHTWPGALQIGGGINISNAQNWLQEGASKVIVTSWLFP-DAQFDLDRLKAISSKIGKDRLVVDVSCRR-KDNRWFAAIN 152 fission yeast
731787    72 ALQESPQFLQVGGGINDTNCLEWLKW-ASKVIVTSWLFTkEGHFQLKRLERLTELCGKDRIVVDLSCRKtQDGRWIVAMN 150 baker's yeast
15227607 196 RWQKFSDVILDEKSLEFLGGFSDEFLVHGVDVEGKKLGIDEELVALLGNYSP----IPVTYAGGVTVMDDVERIKDAGKG 271 thale cress
1723254  153 KWQVMTAFELNEENLDLLSQYCSEFLIHAADVEGLCKGIDEDLVIKLGEWVK----IPTTYAGGGRSIEDLDLVDKLSKG 228 fission yeast
731787   151 KWQTLTDLELNADTFRELRKYTNEFLIHAADVEGLCGGIDELLVSKLFEWTKdyddLKIVYAGGAKSVDDLKLVDELSHG 230 baker's yeast
15227607 272 RVDVTVGSALDIFGG-NLPYKDVVAWHHKQHSLH 304 thale cress
1723254  229 KVDLTIGSALDIFGG-VLEFTRVVAWNRRFTPLP 261 fission yeast
731787   231 KVDLTFGSSLDIFGGnLVKFEDCCRWNEKQG--- 261 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap