Conserved Protein Domain Family
KOG2833

?
KOG2833: KOG2833 
KOG2833, Mevalonate pyrophosphate decarboxylase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 230772
View PSSM: KOG2833
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11281655   3 TEKWVFMVTAQT--PTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGKEISLS-GSRY 79  thale cress
28381624   1 ----MFSVTCVA--PVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEEVPFEeSSRL 74  fruit fly
15224931   3 EEKWVVMVTAQT--PTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLNGKEISLS-GSRY 79  thale cress
17537203   3 QDDGAAEAEATV-----------------------------------------------------EINGKSVELSsNKRY 29  Caenorhabditis elegans
17537201   3 QDDGAAEAEATVrvPMNIALVKYWGKRDDLLILPLNDSISLTV--DRLTAETTIRMVPGVGKHTVEINGKSVELSsNKRY 80  Caenorhabditis elegans
19074299   1 MKKPLSGYGSSH--P-NIAVIKYWGKADTINNMPSSRSISFPLTN----FLTETVVEHSLEEDRFYLNGKMLPIG--EKM 71  Encephalitozoon cun...
1706681    3 SEKPLAAVTCTA--PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVG-QPRL 79  human
19114939   1 MDKKVYQCTVSA--PVNIAVIKYWGKRDVALNLPTNSSISVTLSQDDLRTVTTASCSEKFENDTLWLNGNAEEIFaNKRL 78  fission yeast
1706682    1 --MTVYTASVTA--PVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNGEPHSID-NERT 75  baker's yeast
11281655  80 QNCLREIRGRAGDVEDMEKgiKIRKKDweK----LNLHIASHNNFPTAAGLASSAAGFACLVFSLAKLMNVDEDPSHLSA 155 thale cress
28381624  75 QRCLNEVHRLAVASG-SQ---KVPPT--------WKLHIASVNNFPTAAGLASSAAGYACLVYSLSRLYDIPLN-EELTT 141 fruit fly
15224931  80 QNCLREIRSRADDVEDKEKgiKIAKKDweK----LHLHIASHNNFPTAAGLASSAAGFACLVFALAKLMNVNEDPSQLSA 155 thale cress
17537203  30 QTVFDEALRLQRKRKEAEAs-SADSNGndPppifYHFHVTSTTNFPVAAGLASSAAGFAAIALAIQRILRLDDS--QANR 106 Caenorhabditis elegans
17537201  81 QTVFDEALRLQRKRKEAEAs-SADSNGndPppifYHFHVTSTTNFPVAAGLASSAAGFAAIALAIQRILRLDDS--QANR 157 Caenorhabditis elegans
19074299  72 GRAVEIFRKKSGDDR--------------------PVCIRSFSNFPHSCGLASSASGLAALVLALNDFYGLDMPEEELCI 131 Encephalitozoon cun...
1706681   80 QACLREIRCLARKRRNSRDgdPLPSSl--S----CKVHVASVNNFPTAAGLASSAAGYACLAYTLARVYGVESD---LSE 150 human
19114939  79 RVCVEELRKARLDLEEEND--DLDKIG--A----LKLHVVSENNFPTAAGLASSAAGYAAFCEAIARLYDLPWTPTQLSR 150 fission yeast
1706682   76 QNCLRDLRQLRKEMESKDA--SLPTLS--Q----WKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISR 147 baker's yeast
11281655 156 IARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQLADEKHWDDLVIIIAV------ETSSTSGMRESVETSLLLQHRAK 229 thale cress
28381624 142 VARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDHWPNMHVLILVvndarkKTASTRGMQQAVKTSQLIKHRVD 221 fruit fly
15224931 156 IARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAVQLVDDKHWDDLVIIIAVvssrqkETSSTSGMRESVETSLLLQHRAK 235 thale cress
17537203 107 LARIGSGSACRSMYGGLVHWRKGEMDDGSDCLAVRTEAAANWEDLYCIILVfddgrkKVGSSEGMRRSRETSQLLKHRIE 186 Caenorhabditis elegans
17537201 158 LARIGSGSACRSMYGGLVHWRKGEMDDGSDCLAVRTEAAANWEDLYCIILVfddgrkKVGSSEGMRRSRETSQLLKHRIE 237 Caenorhabditis elegans
19074299 132 AARIGSGSAGRSISTGIHLF------DG---MSVERLPS--WKEVRILSIIlsgdckKTGSTEGMIRTKETSNFYQERLA 200 Encephalitozoon cun...
1706681  151 VARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVvsaekkLTGSTVGMRASVETSPLLRFRAE 230 human
19114939 151 IARQGSGSACRSLFGGYVAWEMGELHSGADSVAVQVEPVENWPEIRVAVLVasaakkGVSSTAGMQATVASSTLFQHRIQ 230 fission yeast
1706682  148 IARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQIADSSDWPQMKACVLVvsdikkDVSSTQGMQLTVATSELFKERIE 227 baker's yeast
11281655 230 EVVPKRILQMEEAIKNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNA 309 thale cress
28381624 222 QVVPDRIIRLREAIASHDFQAFAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNA 301 fruit fly
15224931 236 EVVPVRILQMEEAIKNRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFDAGPNA 315 thale cress
17537203 187 SIVPQRIQQIQEAYTSRNFEQLARVIMADSNQFHAVCMDSTPPIRYLNEASWQLIDTVEEFN--IGGIRAAYTFDAGPNA 264 Caenorhabditis elegans
17537201 238 SIVPQRIQQIQEAYTSRNFEQLARVIMADSNQFHAVCMDSTPPIRYLNEASWQLIDTVEEFN--IGGIRAAYTFDAGPNA 315 Caenorhabditis elegans
19074299 201 R-IERKIKAMVQYISQKDFDGFAHLTMRESNELHAILMETYPPIRYIRDDGFKVIEMCHEFN--RDRTRVAYTFDAGPNP 277 Encephalitozoon cun...
1706681  231 SVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNA 310 human
19114939 231 NIVPQRIQEMKTAIRERDFETFAKLTMTDSNQFHACCLDTFPPIFYLNDTSRAVIRVVENINATAGKTIAAYTFDAGPNA 310 fission yeast
1706682  228 HVVPKRFEVMRKAIVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDAGPNA 307 baker's yeast
11281655 310 VLIARNRKVAvQLLQGLLYYFPPKSDTDmKSYVVGDNSILKEAGLDGasgvenlqpppEIKDNIGSQdqkGEVSYFICTR 389 thale cress
28381624 302 CLYVLAEHVP-HLLSAIQKVFPNDLADGg-TYLRG-LPIPKVQDAES-----------SKLDSLDVHa-kNAFRYIIHTK 366 fruit fly
15224931 316 VMIARNRKVAvELLQGLLYCFPPKPDTDmKSYVLGDTSIVKEAGLEGel-------pqGIKDKIGSQdqkGEVSYFICSR 388 thale cress
17537203 265 CVIVQKENAS-QFLKAVLQ-TIQVPSEDlQVIGKELAEQFDVPAEPT-----------------------TKCSKLIMSP 319 Caenorhabditis elegans
17537201 316 CVIVQKENAS-QFLKAVLQ-TIQVPSEDlQVIGKELAEQFDVPAEPT-----------------------TKCSKLIMSP 370 Caenorhabditis elegans
19074299 278 FLITLEQHLH--AVEDFFKAYELVPCNY---------------------------------------------------- 303 Encephalitozoon cun...
1706681  311 VIFTLDDTVA-EFVAAVWHGFPPGSNGD--TFLKG--LQVRPAPLSA-----------ELQAALAMEptpGGVKYIIVTQ 374 human
19114939 311 VIYFLEENSE-IVLNTLYAVTKNAEGWS-KQYGSSPVTVDS---AAAni--------vS-----------SGISRVILTR 366 fission yeast
1706682  308 VLYYLAENES-KLFAFIYKLFGSVPGWD-KKFTTEQLEAFNHQFESSnf--------tARELDLELQ---KDVARVILTQ 374 baker's yeast
11281655 390 PGKGPIvLHDQTQALLDPEtGLPK 413 thale cress
28381624 367 VGEGPKeLSADNSLLIN---GLPL 387 fruit fly
15224931 389 PGRGPVvLQDQTQALLHPQtGLPK 412 thale cress
17537203 320 MGGGP---QE-------------- 326 Caenorhabditis elegans
17537201 371 MGGGP---QE-------------- 377 Caenorhabditis elegans
19074299     ------------------------ Encephalitozoon cuniculi
1706681  375 VGPGPQiLDDPCAHLLGPD-GLPK 397 human
19114939 367 VGNGPR-VLTIDESLIDAS-GNPK 388 fission yeast
1706682  375 VGSGP---QETNESLIDAKtGLPK 395 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap