Conserved Protein Domain Family
KOG2795

?
KOG2795: KOG2795 
KOG2795, Catalytic subunit of the meiotic double strand break transesterase [Replication, recombination and repair]
Statistics
?
PSSM-Id: 230734
View PSSM: KOG2795
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15241959  42 IKAAAGAGGassssSKPLTLADLSLSsscrevaDLSLSSVQTEIETVIVQIARSilagDGFSFSVPSRAASNQLYVPELD 121 thale cress
7302468    1 -------------------MDEFSEN--------I--ERIALELLSNLVHGN--------ATLSVPRNSSGNVISEYRRV 43  fruit fly
15231162   1 ------------------MEGKFAISes----tNL-LQRIKDFTQSVVVDLA------EGRSPKISINQFRNYCMNPEAD 51  thale cress
3025217    6 FNPNIDHEPgsvesQQSTIYSDSDDS---------DDSFLDDEVIPPKEQAMRK----IEFALADIKRQMDNKEKSLTLR 72  Caenorhabditis elegans
19074189   1 ------------------------------------------------------------MALAPTSSAISGSLRSSMLK 20  Encephalitozoon cun...
7674367   23 LLAALRRGG-----REPPTGGSRLASs-----sEV-LASIENIIQDIITSLARN----EAPAFTIDNRSSWENIKFEDSV 87  human
3123261    1 -------------------MNSNDKK-------KVVRSWIEQFVHDFVEQLSKP----TKDSVNVALKRRKHNSWNGSLD 50  fission yeast
134746    10 YKTRQELVKaltpkRRSIHLNSNGHSngtpcsnADVLAHIKHFLSLAANSLEQHq---QPISIVFQNKKKKGDTSSPDIH 86  baker's yeast
30696943   1 MEESSGLSSmkffsDQHLSYADILLP-------HEARARIEVSVLNLLRILNSPd--pAISDLSLINRKRSNSCINKGIL 71  thale cress
15241959 122 RIVLKDKSTLRPFASVSs----VRKTTITTRILALIHQLCLRNIHVTKRDLFY----TDVKLFQDQTQSDAVLDDVSCML 193 thale cress
7302468   44 SYNNRG---------SR------HSFCVLIYMLSRVHRLQVRGGSFTVRGLYY----DNPLLVRSQSRIAEARLDVCRML 104 fruit fly
15231162  52 CLCSSDKPKGQEIFTLKke-pqTYRIDMLLRVLLIVQQLLQENRHASKRDIYY----MHPSAFKAQSIVDRAIGDICILF 126 thale cress
3025217   73 ISTSKSHFCLRYTAKRK------GKLDRDLHCLHQVYDLLENDKRSTKRELYY----EHKAVYGNQKYLDSSIKSICELL 142 Caenorhabditis elegans
19074189  21 LLMRLK---------S-------RTLATRLRLYEIIIEMQELGITRNEREIFY----MDVNVFRTQSVVRRLVSSIASEL 80  Encephalitozoon cun...
7674367   88 GLQMVSHCTTRKIKSDSpk--sAQKFSLILKILSMIYKLVQSNTYATKRDIYY----TDSQLFGNQTVVDNIINDISCML 161 human
3123261   51 SKANERQKVKVFSFPRNe-----TTIAQLFRVLDCVHEAVISDTVITKRDIYY----RDVDLFKRQTVVDELLGDISNTI 121 fission yeast
134746    87 TTLDFPLNGPHLCTHQFk----LKRCAILLNLLKVVMEKLPLGKNTTVRDIFY----SNVELFQRQANVVQWLDVIRFNF 158 baker's yeast
30696943  72 TDVSYIFLSTSFTKSSLtnaktAKAFVRVWKVMEICFQILLQEKRVTQRELFYkllcDSPDYFSSQIEVNRSVQDVVALL 151 thale cress
15241959 194 GCT-RSSLNVIAAEKGVVVGRLIFSD-NGDMIDCTK--------MGMGGKAIPPNIDRVGD--MQSDAMFILLVEKDAAY 261 thale cress
7302468  105 RTS-PLSLGILAASKGLVAGDLRLLMtNGDVLDSS---------LYGGPLTLPTDPEKIDR--IETLAEFVLIVEKESVF 172 fruit fly
15231162 127 QCS-RYNLNVVSVGNGLVMGWLKFRE-AGRKFDCLN--------SLNTAYPVPVLVEEVED--IVSLAEYILVVEKETVF 194 thale cress
3025217  143 NES-RANLNILSCGRGIIRGAITFLVeNVGVIDAR------------VQEVLITDALLFSN--IISEADFILVVEKDTTF 207 Caenorhabditis elegans
19074189  81 QIS-KHDLGVRNTLKGIFIGRLGFVRhHGLGMVEMS--------SKGGCPQLIPDMSDIAE--VLCDYKKTVVVEKDTVL 149 Encephalitozoon cun...
7674367  162 KVS-RRSLHILSTSKGLIAGNLRYIEeDGTKVNCT---------CGATAVAVPSNIQGIRN--LVTDAKFVLIVEKDATF 229 human
3123261  122 GCS-RSDLNVEASAKGLVFGSIHIALeNGTVITAT--------------KPLLISHHRISS--ITSTAKWVLVIEKEAVF 184 fission yeast
134746   159 KLSpRKSLNIIPAQKGLVYSPFPIDIyDNILTCENEpkmqkqtiFPGKPCLIPFFQDDAVIklGTTSMCNIVIVEKEAVF 238 baker's yeast
30696943 152 RCS-RYSLGIMASSRGLVAGRLFLQEpGKEAVDCSA--------CGSSGFAITGDLNLLDNtiMRTDARYIIIVEKHAIF 222 thale cress
15241959 262 MRLAEDRFYNRF--PCIIVTAKGQPDVATRLFLRKMKMEL-KL--PVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTT 336 thale cress
7302468  173 ESLLSRNVFGTFerRFILITGKGYPDCCTRRIVHRLTEEN-QL--AAYILVDADPFGVEIMLVYRHGSKSMSFSSQGLTT 249 fruit fly
15231162 195 QRLANDMFCKTN--RCIVITGRGYPDVSTRRFLRLLMEKL-HL--PVHCLVDCDPYGFEILATYRFGSMQMAYDIESLRA 269 thale cress
3025217  208 QKLMDENFQAMFp-RGILATSKGYPDIATRNVLKMLSEKR-KF--PIYGLFDADPHGIEIYLTYKYGPTKEFAEGRGAFV 283 Caenorhabditis elegans
19074189 150 QRIASEIEREKCleEILFVCGKGYPCKNTVLLLKMIEHKT-----AVAGLFDLDPFGIHIFCIYKYGSK----ETPDIRV 220 Encephalitozoon cun...
7674367  230 QRLLDDNFCNKLs-PCIMITGKGVPDLNTRLLVKKLWDTF-HV--PVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTV 305 human
3123261  185 QTLTEEALADTI-----IVTAKGFPDLMTRKFLVKLAKALpDA--KFFGIFDWDPHGLCIYSCFKYGSNAYSHEPHSQL- 256 fission yeast
134746   239 TKLVNNYHKLSTn--TMLITGKGFPDFLTRLFLKKLEQYCsKLisDCSIFTDADPYGISIALNYTHSNERNAYICTMANY 316 baker's yeast
30696943 223 HRLVEDRVFNHI--PCVFITAKGYPDIATRFFLHRMSTTFpDL--PILVLVDWNPAGLAILCTFKFGSIGMGLEAYRYA- 297 thale cress
15241959 337 PDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDFVKKN-PGWVEELNLMVKTKQKAEIQALSSFGFQYLSEV 415 thale cress
7302468  250 PALRWIGLHPSEIPALGTG---AVALVAGDNKKINDLLARHDLEPG---VRQELRMLQDVQLKAEIES--V--IDFLTDD 319 fruit fly
15231162 270 PDMKWLGAFPSDSEVYSVPKQCLLPLTEEDKKRTEAMLLRCYLKREmPQWRLELETMLKRGVKFEIEALSVHSLSFLSEV 349 thale cress
3025217  284 PTIEWIGLFPTDFHRFTIDQSQCLPLVRTDFVKIEKMIPRSIQLGE-IVVTRELDWMIQNKFKMELESINMCGQEYMARF 362 Caenorhabditis elegans
19074189 221 ETIMRIGVCMEDVLEKNAYKDVFVKLNVHDLKMINRLVRFGELSAD-----LLFLRKIDG--KVEMEALFSK-EPRRLRY 292 Encephalitozoon cun...
7674367  306 PAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQ-PFWRKEMEIMADSKMKAEIQALTFLSSDYLSRV 384 human
3123261  257 RNLQLLGPLYEDIFNKNQE--FSLKLNKRDIKMITTLLQFEGFQKE-PVVREQLQRMLFIQKKAEIQAILEFPSWIKGKL 333 fission yeast
134746   317 KGIRITQVLAQNNEVHNKS-IQLLSLNQRDYSLAKNLIASLTANSW-----DIATSPLKN-VIIECQREIFFQKKAEMNE 389 baker's yeast
30696943 298 CNVKWIGLRGDDLNLIPEE--SLVPLKPKDSQIAKSLLSSKILQEN---YIEELSLMVQTGKRAEIEALYCH-GYNYLGK 371 thale cress
15241959 416 YLPLKLQQQDWL 427 thale cress
7302468  320 YIPNKINRNLFL 331 fruit fly
15231162 350 YIPSKIRREVSS 361 thale cress
3025217  363 LIAPRVMSIEKE 374 Caenorhabditis elegans
19074189 293 FLFRMLERISS- 303 Encephalitozoon cuniculi
7674367  385 YLPNKLKFGGWI 396 human
3123261  334 ADADKSGKHSVR 345 fission yeast
134746   390 IDARIFEYK--- 398 baker's yeast
30696943 372 YIATKIVQGKYI 383 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap