Conserved Protein Domain Family
KOG2584

?
KOG2584: KOG2584 
KOG2584, Dihydroorotase and related enzymes [Nucleotide transport and metabolism]
Statistics
?
PSSM-Id: 230523
View PSSM: KOG2584
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723    7 PVKKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSseITIPG----GVRTIDASGLMIIPGGIDPHTH 82
gi 10727156   7 PVKKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFVGPSseITIPG----GVRTIDASGLMIIPGGIDPHTH 82
gi 9759387   32 GRENGVGSCGVSSTRILIKGGTVVNAHHQELADVYVENGIIVAVQPN--IKVGD----EVTVLDATGKFVMPGGIDPHTH 105
gi 3122032    1 -----------MS--LLIKNGTIVNDDAIFKSDVLVLDGRIVEIAPS--IQPTP----GLEVVDATDRLVIPGGIDPHTH 61
gi 25992878   1 -----------MSPPLVIKNGTVVNEDGMFKADVLVRNGIIVEVSPN--ITALP----DTEVIDATDRLVIPGGIDPHTH 63
gi 3122042    2 SFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGEN--LIVPG----GIKTIDAHGLMVLPGGVDVHTR 75
gi 30156930     --------------------------------------------------------------------------------
gi 20137929   1 ------MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRE--LMIPG----GAKVIDATGKLVIPGGIDTSTH 68
gi 3122031    2 SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGEN--LIVPG----GVKTIEANGRMVIPGGIDVNTY 75
gi 3122049    1 ---------MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHD--LLPPGgapaGLRVLDAAGKLVLPGGIDTHTH 69
gi 3122051    2 SYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGEN--LIVPG----GVKTIEAHSRMVIPGGIDVHTR 75
gi 3122050    2 SYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDN--LIVPG----GVKTIEANGKMVIPGGIDVHTH 75
gi 728828     1 MPINAITSDHVIINGANKPATIVYSTESGTILDVLEGS-VVMEKTEItkYEIHT-------LENVSPCTILPGLVDSHVH 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723   83 MQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNK--HESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIG 160
gi 10727156  83 MQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNK--HESMIEAYDKWRSWADPKVCCDYGLHVGITWWSKSVSEEIG 160
gi 9759387  106 LAMEFMGTETIDDFFSGQAAALAGGTTMHIDFVIPVN---GNLVAGFEAYENKSR-ESCMDYGFHMAITKWDEGVSRDME 181
gi 3122032   62 MQLPFMGEIAKDDFHRGTEAAVAGGTTMIIDFVIPTK--GESLLVAYDRWRGWADPKVVCDYGLSMAITSWGPEIAKEME 139
gi 25992878  64 MQMPYMGEVTKDDFLKGTEAAVAGGTTMIIDFCCPDHrnGESLIAGYNRWRSWADPKVCCDYGLSVAITMWRPETAEQMA 143
gi 3122042   76 LQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDT--GVSLLAAYERWRERADSAACCDYSLHVDITRWHESIKEELE 153
gi 30156930     --------------------------------------------------------------------------------
gi 20137929  69 FHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDK--ETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEME 146
gi 3122031   76 LQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEP--GSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELE 153
gi 3122049   70 MQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQK--GGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMK 147
gi 3122051   76 FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEP--GTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEME 153
gi 3122050   76 FQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEP--ESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQ 153
gi 728828    73 LNEP--GRTSWEGFETGTQAAISGGVTTVVDMPLNAIp-PTTNVENFRIKLEAAEGQMWCDVGFWGGLVP--HNLPDLIP 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723  161 ILC-KELGVNSFKTFMAYKGLYQ---------------------LNDSDLLDVFERIRHLNGVAMVHAENGDIIAKNTQR 218
gi 10727156 161 ILC-KELGVNSFKTFMAYKGLYQlndsdlldvferirhlngvamV---------------------HAENGDIIAKNTQR 218
gi 9759387  182 MLV-KEKGINSFKFFLAYKGSLM---------------------VTDDLLLEGLKRCKSLGALAMVHAENGDAVFEGQKR 239
gi 3122032  140 IVTgAEYGINSFKFFLAYAGVFM---------------------VRDEEFYQGMIQCAKLRALARVHAENGSVIAERCEH 198
gi 25992878 144 IITsPEFGVNSFKFYMAYENTLM---------------------VRDDELFRGMQECAKLRALARVHCENGSVIKEKEID 202
gi 3122042  154 ALV-KEKGVNSFLVFMAYKDRCQ---------------------CSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQKR 211
gi 30156930     --------------------------------------------------------------------------------
gi 20137929 147 TLV-REKGVNSFQMFMTYKDLYM---------------------LRDSELYQVLHACKDIGAIARVHAENGELVAEGAKE 204
gi 3122031  154 VLV-QDKGVNSFQVYMAYKDVYQ---------------------MSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKR 211
gi 3122049  148 ILV-QDKGVNSFKMFMAYKDLYM---------------------VTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKK 205
gi 3122051  154 ALV-KDHGVNSFLVYMAFKDRFQ---------------------LTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQR 211
gi 3122050  154 NLI-KDKGVNSFMVYMAYKDLYQ---------------------VSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTR 211
gi 728828   148 LVKaGVRGFKGFLLDSGVEEFPP---------------------IGKEYIEEALKVLAEEDTMMMFHAELPKAHEDQQQP 206
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723  219 LLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQMKTPLFVSGLTSKSSAELVGRARR--SGYCVFGETLASSLGRSMSA 296
gi 10727156 219 LLAEGINGPEGHELSRPEEVEAEAVHRACVLAHQADCPLYVVHVMSKSAGIELARARHryRGRYIMGETLAAALGTDATC 298
gi 9759387  240 MIELGITGPEGHALSRPPVLEGEATARAIRLARFINTPLYVVHVMSVDAMDEIAKARK--SGQKVIGEPVVSGLILDDHW 317
gi 3122032  199 LLSSGITGPEGHTQSRPEELEAEATFRACTMASQANCPLYVVHVMSKGAAAAIAHHRK--KGAVVFGEPIAAGLATDGSH 276
gi 25992878 203 LLAKGVTGPEGHTQSRPEEIEAEATNRACVLAAQANCPVYIVHVMTKGAASAISHHRA--QGSIVFGEPIAAGLALDGSH 280
gi 3122042  212 LLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAADAIAQAKR--RGVVVFGEPITASLGTDGSH 289
gi 30156930     --------------------------------------------------------------------------------
gi 20137929 205 ALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKM--QGKVVLAETTTAHATLTGLH 282
gi 3122031  212 ILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARK--KGPLVFGEPIAASLGTDGTH 289
gi 3122049  206 MLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARR--DGKVVYGEPIAASLGTDGTH 283
gi 3122051  212 ILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARK--KGTVVYGEPITASLGTDGSH 289
gi 3122050  212 MLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARK--KGNVVFGEPITASLGIDGTH 289
gi 728828   207 EQSHREYS--SFLSSRPDSFEIDAINLILECLRARNGPVPPVHIVHLASMKAIPLIRK---ARASGLPVTTETCFHYLCI 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723  297 VPKG---DRIYAITSPPIRESAETPRQLMKSLAYDDLQLTGSDNCTFNKEHKALGKGDFTKIPNGVNGVEDRMSLVWEKG 373
gi 10727156 299 CQHLgfdAEAAHVLSPPLRPDKTTPEFLMKLLAK---------------------------------------------- 332
gi 9759387  318 LWDPdftIASKYVMSPPIRPVG-HGKALQDALSTGILQLVGTDHCTFNSTQKALGLDDFRRIPNGVNGLEERMHLIWDTM 396
gi 3122032  277 YYNEdwlHAARYVMSPPLSRDPSTPSALMKLLAAGELHLTATDNCTFDCQQKSLGKDDFTKIPNGVNGVEDRMSVVWDKG 356
gi 25992878 281 YYNEdwlHAARYVMSPPLSRDPTTPELLMKLLAAGELHLTGTDNCTYDCRQKSLGKGNFTKIPNGINGVEDRMSVVWEKG 360
gi 3122042  290 YWSKnwaKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKC 369
gi 30156930     --------------------------------------------------------------------------------
gi 20137929 283 YYHQdwsHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVIWERG 362
gi 3122031  290 YWSKnwaKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKA 369
gi 3122049  284 YWNKewhHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKG 363
gi 3122051  290 YWSKnwaKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKA 369
gi 3122050  290 YWSKnwaKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKA 369
gi 728828   282 AAEQipdGATYFKCCPPIRSES-NRQGLWDALREGVIGSVVSDHSPCTPELKNLQKGDFFDSWGGIASVGLGLPLMFTQG 360
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296723  374 VHAGLLDPCRFVAVTSTNAAKIFNIYPQKGRIAVGSDADIVIWNPNATRTISKDTHHHACDFNIFEGMTVHGVCEFVLVR 453
gi 10727156     --------------------------------------------------------------------------------
gi 9759387  397 VESGQLSATDYVRITSTECARIFNIYPRKGAILAGSDADIIILNPNSSYEISSKSHHSRSDTNVYEGRRGKGKVEVTIAG 476
gi 3122032  357 VHAGIIDPMRFVAVTSTMAAKIFNCYPQKGRIAVGSDADIVIWNANATRTISKDTHHHAIDFNIFEGMQVHGVPEITISR 436
gi 25992878 361 VHSGIIDPMRYVSITSSTAAKIFNIYPRKGRIAVGSDADIVIFNPNATRTISKDTHHHnldfnifeginchgvaevtisr 440
gi 3122042  370 VASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQ 449
gi 30156930   1 ---------------MDENCFVLSLYSHKGLIISGANTDVVVWDPEGTKIISASTLVQGGNFNLNENMCYYRMPLLTIDP 65
gi 20137929 363 VVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISR 442
gi 3122031  370 VATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQ 449
gi 3122049  364 VHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISR 443
gi 3122051  370 VVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQ 449
gi 3122050  370 VATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQ 449
gi 728828   361 CS-----LVDIVTWCCKNTSHQVGLSHQKGTIAPGYDADLVVFDTASKHKISNSSVYFKNKLTAYNGMTVKGTVLKTILR 435
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7296723  454 GRICAERGNVRVAEGFGRFIPTPVRPPFVYDIIEGKVQSQPEEQHEEKQNGSMAKRFAe-LDIQIPVQEPISAMLA 528
gi 10727156     ----------------------------------------------------------------------------
gi 9759387  477 GRIVWENEELKVVPRSGKYIEMPPFS-YLFDGIEKSD--ANYLSSLRAPVKRVRTEAT------------------ 531
gi 3122032  437 GRTVWANGQLKTVQGSGQFIPLAPDSQIVFSAVDNRKKAMEPVKIDRIPYEPSALQTPd-ANANIVVKAPVRAAIP 511
gi 25992878 441 grivwahgklqtvpgsgkfipllanspfvfsthekreqkiqpriverle--------------------------- 489
gi 3122042  450 GRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGLYDGPVHEVM--VPAKPGSGAPARASCP 523
gi 30156930  66 GGAVYENGIFMCTEGTGQTVSCG------LSQLNHRKNTLNIKGVTVLPTWgrrdlpefiyslsgsqfddhvlkrv 135
gi 20137929 443 GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVhpGKKEMGTPLADTPTRP 518
gi 3122031  450 GKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVP--ATPKYATPAPSAKSSP 523
gi 3122049  444 GKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKsrVTKEDATAGTRKQAHP 519
gi 3122051  450 GKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVS--VTPKTVTPASSAKTSP 523
gi 3122050  450 GKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLT--TTPKGGTPAGSARGSP 523
gi 728828   436 GQVVYTNANGVSKTPLGQTLLDSRR--------------------------------------------------- 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap