Conserved Protein Domain Family
KOG2535

?
KOG2535: KOG2535 
KOG2535, RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics, Transcription]
Statistics
?
PSSM-Id: 230474
View PSSM: KOG2535
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19173436  35 AGPARSFPKELIRPSVSPRMSdFLKACNEISSEIVELYKQ--EKRIDVSAIKSRVCRKYRLGCTPRIVDIISFIP---PE 109 Encephalitozoon cun...
7295707    1 MKAKKKLGV-----GLSRQER-QVLVIGEIIQELLKAHEA--KKDVNLNRMKSLVASKYGLDSSPRLVDIIAAVPq--DA 70  fruit fly
9758914    6 KKQPRPGKGGYQGRGLTEEEA-RVRAISEIVSTMIERSHR--NENVDLNAIKTAACRKYGLARAPKLVEMIAALPd--SE 80  thale cress
17566948   6 IQMDQKG-------SQ--RAL-LAQTINEIVKLLIEAHNQ--KKDVNLNRLKCIVAQKNGLSFQPKLVDIIAGVPs--DY 71  Caenorhabditis elegans
10434125   1 MRQKRKG-------DLSPAEL-MMLTIGDVIKQLIEAHEQ--GKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPp--QY 68  human
7022443    1 MRQKRKG-------DLGPAEL-MMLTIGDVIKQLIEAHEQ--GKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPp--QY 68  human
19115774   1 ---------MSTSSLAFLK----AKACAEIVAELIASENQ--NKVINLNALKMRISKKHQLSESPRLTDIIAAIPpdaYL 65  fission yeast
6325171    1 MARHGKGPKTNKKKLAPEKER-FIQCCADITLELTDSLTSgtTREINLNGLITKYSKKYKLKQQPRLTDIINSIPd--QY 77  baker's yeast
19173436 110 HGRLIEQLRAKPVRTASGVAVVAVMCKPHRCPHIALTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRSRYDPFEQA 189 Encephalitozoon cun...
7295707   71 KKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRSRYDPFLQT 150 fruit fly
9758914   81 RETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQA 160 thale cress
17566948  72 KDSLLPKLKAKPVRTASGIAVVAVMSKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQT 151 Caenorhabditis elegans
10434125  69 RKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQT 148 human
7022443   69 RKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQT 148 human
19115774  66 KESLMRKLRAKPVRTASGIAVVAVMCKPHRCPHIAMTGNVCVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQA 145 fission yeast
6325171   78 KKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQA 157 baker's yeast
19173436 190 RERLRQLKALGHNTDKVEYIIMGGTFMSLPESYRDRFISRLHDALSGHTSPTVEEAIRVGAEGRLKCVGITIETRPDFCV 269 Encephalitozoon cun...
7295707  151 RHRVEQLKQLGHSVDKVEFIVMGGTFMCLPEEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCL 230 fruit fly
9758914  161 RSRIDQLKRLGHSVDKVEFILMGGTFMSLPAEYRDFFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIETRPDYCL 240 thale cress
17566948 152 RGRLNQLMQLGHSVDKVEFIVMGGTFMSLPEDYRDFFIRNLHDALSGHTSASVEEAVAYSERSKMKCIGITIETRPDYCL 231 Caenorhabditis elegans
10434125 149 RHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCM 228 human
7022443  149 RHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCM 228 human
19115774 146 RGRVEQLRSLGHTVDKVEYIIMGGTFMSLPESYRHTFIANLHNALSGATTEDLDEAVKFSEQSETKCVGITIETRPDYCL 225 fission yeast
6325171  158 RGRVEQLKQLGHSIDKVEYVLMGGTFMSLPKEYREDFIVKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCT 237 baker's yeast
19173436 270 RPHLSKMLGYGCTRIEVGVQSVYEDVARDTNRGHTVESVCESFALAKDAGFKIVAHMMPNLPNVPMKRDLAQFREYFDNP 349 Encephalitozoon cun...
7295707  231 KRHISDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDIEQFIEYFENP 310 fruit fly
9758914  241 GPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAHMMPDLPNVGVERDMESFKEFFESP 320 thale cress
17566948 232 PRHLNDMLLYGCTRLEIGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLERDKEQFLELFESP 311 Caenorhabditis elegans
10434125 229 KRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVMAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENP 308 human
7022443  229 KRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENP 308 human
19115774 226 DQHLDEMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFQLAKDTGYKVVTHMMPDLPNVGMERDIFQFQEYFENP 305 fission yeast
6325171  238 QTHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPNVGMERDIEQFKEYFENP 317 baker's yeast
19173436 350 GFRSDGLKIYPTLVIKGTGLFELWKNNKYRNYSPDELIDLLARILSLVPPWMRIYRVQRDIPMTLVSSGVEHGNIRELAL 429 Encephalitozoon cun...
7295707  311 AFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAL 390 fruit fly
9758914  321 SFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELAL 400 thale cress
17566948 312 AFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYRVQRDIPMPLVSSGVEHGNLREHAM 391 Caenorhabditis elegans
10434125 309 AFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAL 388 human
7022443  309 AFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAL 388 human
19115774 306 AFRTDGLKLYPTLVIRGTGLYELWKTGRYKNYTPNALVDLIARILALVPPWTRIYRIQRDIPMPLVSSGVETGNLRELAL 385 fission yeast
6325171  318 DFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELAL 397 baker's yeast
19173436 430 ARMKDYRTRCRDIRTREVGIRNIHENILPEEVELVRRDYVANKGWETFLSYEDVKQDILIGLLRLRKCSVDTFRTELRGL 509 Encephalitozoon cun...
7295707  391 ARMKDLGTTCRDVRTREVGIQEIHNKVRPYEIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGE 470 fruit fly
9758914  401 ARMDDLGLKCRDVRTREAGIQDIHHKIKPEQVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGKNVTCPELMGK 480 thale cress
17566948 392 AKMKELGLKCRDVRTREVGIQEIHNKVRPEDVELIRRDYTANGGWETFISYEDPKQDILIGLLRLRKISDKAHRPELKGN 471 Caenorhabditis elegans
10434125 389 ARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGG 468 human
7022443  389 ARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSER--------- 459 human
19115774 386 NRMRDLGTKCRDIRAREVGMQEVHHKIHPEQVELLRRDYTANGGWETFLSYEDPKQDILIGLLRLRQCSDK-TYRPEFTS 464 fission yeast
6325171  398 ARMKDLGTTCRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTS 477 baker's yeast
19173436 510 glqpaanegsleadghhpavvnEhsSIIRELHVYGSAAAISKSDGTKYQHQGYGTLLIAEAERIARDEHKSAKIAIISGV 589 Encephalitozoon cun...
7295707  471 ----------------------C--SIVRELHVYGSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGV 526 fruit fly
9758914  481 ----------------------C--SVVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVISGV 536 thale cress
17566948 472 ----------------------V--SVVRELHVYGSVVSVADRDPKKFQHQGYGSLLMEEAERIAREEHGSDKIAVISGV 527 Caenorhabditis elegans
10434125 469 ----------------------V--SIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGV 524 human
7022443  460 ---------------------------------------------------------------IAREEHGSGKIAVISGV 476 human
19115774 465 ----------------------QptSLVRELHVYGSAVPVHSRDPKKFQHQGFGTLLLEEAERIAKYEHGSKKISVISGV 522 fission yeast
6325171  478 ----------------------QrtSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGV 535 baker's yeast
19173436 590 GTRNYYARFGYVLEGPYMVKSLT 612 Encephalitozoon cuniculi
7295707  527 GTRNYYRKMGYQLDGPYMSKSIE 549 fruit fly
9758914  537 GTRHYYRKLGYELEGPYMVKHLL 559 thale cress
17566948 528 GTREYYRKLGYELDGPYMSKMLD 550 Caenorhabditis elegans
10434125 525 GTRNYYRKIGYRLQGPYMVKMLK 547 human
7022443  477 GTRNYYRKIGYRLQGPYMVKMLK 499 human
19115774 523 GVRKYYQKLGYTLDGPYMSKWL- 544 fission yeast
6325171  536 GVRNYYGKLGYELDGPYMSKRI- 557 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap