Conserved Protein Domain Family
KOG2531

?
KOG2531: KOG2531 
KOG2531, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 230470
View PSSM: KOG2531
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1723736    3 CSVIQRQTRevSntmsldsyYLGFDLSTQQLKCLAINQDLKIVHSETVEFEK--DLPHYHTKKGVYIHG---DTIECPVA 77  baker's yeast
7296167    2 CHRIKQDYSgnS--------YLGLHLGTQLFRALILDSKLNVTYVAQIRYDV--DLPEFKTTNGILSDGgpgEFLANPV- 70  fruit fly
7300206    1 MGPPKQLKR--T--------FLGFDLSTQKLKAVLLGSSLEVVAAAEVKFDT--DLPEFRTTGGANAGSiknEYFVQPV- 67  fruit fly
15240526   2 ADLSLPPDS--L--------FLGFDSSTQSMKATVLDSNLNIIKTELVHFDS--DLPQYKTKDGVYRDTtvnGRIVSPTL 69  thale cress
732210     1 -----MKDG-----------FLGIDLSTQQIKAVIIDQNGKVVHTTAINFSTheKLKKFGTENGVHKNG---SVITSPVI 61  Caenorhabditis elegans
18860918   1 -MAEHAPRR--C--------CLGWDFSTQQVKVVAVDAELNVFYEESVHFDR--DLPEFGTQGGVHVHKd-gLTVTSPVL 66  human
19075430   1 -----------M--------FLGLDLSTQQLKGVVIDESLNVHQEVAVDFDR--DLSDYNTIKGVYRNG---YEVFAPVC 56  fission yeast
1723736   78 MWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNkkPEKDLLHYVSSvAFARQTAPNWQDHSTA 157 baker's yeast
7296167   71 MWVKALDMLMDCLVKQGADMHTVVSIAGAAQQHGCVFWSELGLRRLCNLN--VNLRLHEQITEsAFELTRTPTWRDSSTD 148 fruit fly
7300206   68 MWVKAMDIVLDRLVMQQADLSTVAAISGSGQQHGSLYWSKHGINTLQNLD--SEKFLHAQIDDsAFVVNRTPIWMDATTT 145 fruit fly
15240526  70 MWVEAFDLILQKLSNANFDFAKVIAVSGSGQQHGSVYWSKGSSEVLRSLD--SKRSLKEQLEN-AFSVKESPIWMDSSTT 146 thale cress
732210    62 MWIEAIDILFNDLRENGWT-DKLRGISGCAQQHGTVYWKNGAENSLKGLD--ESRSLAEQLEM-CFSVQKSPIWMDSSTE 137 Caenorhabditis elegans
18860918  67 MWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLS--PDLRLHQQLQD-CFSISDCPVWMDSSTT 143 human
19075430  57 MWLDAIDLLFERLKAS-VDVSKIQAISGAGQQHASVFLLKGSKKALNSLD--AKSSLKQQLES--LIHPTSPNWQDASTT 131 fission yeast
1723736  158 KQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYD 237 baker's yeast
7296167  149 VQVREMEHTVGGPAELSKITGSRAYTRFTGPQIRKVYTQCPEQYERTSRISLISSFLASLLIGGIASIDYSDGSGMNLLD 228 fruit fly
7300206  146 KQCLEMEMAVGGKLNMVELTGSKCYERFTGPQIRKIYQQRCHAYEEANRISLVSSFISSLFLGSVAPIDFSDGSGMNLLD 225 fruit fly
15240526 147 LQCKEIENAVGGAMELSKITGSRAYERFTGPQIRKLFMTQGEVYKSTERISLVSSFMASLLVGDYACIDETDAAGMNLMD 226 thale cress
732210   138 KQCQELETFVGGDQEMAKLTGSRAHHRFSAAQIKKIVDEKQDVWKDTEKVSLISSFFASLLIGKYALIELTDGSGMNLMN 217 Caenorhabditis elegans
18860918 144 AQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQ 223 human
19075430 132 KECEELESCIGGAKALADLTGSKAHLRFTGPQIKRFRRLHPETYENTERIALVSNFLASVLLQTEAPLDISDVCGMNLWD 211 fission yeast
1723736  238 IRERKFSDELLHLIDssskdKTIRQKLMrAPMKN-LIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRK-NDVL 315 baker's yeast
7296167  229 IRKKKWSAACLDACA-----PDLARRLM-KPIPSsRLQGRIGDYYVKRWNFRPDCMVVASTGSKASELAGLLVEN-DFLM 301 fruit fly
7300206  226 IRKKNWSKECLNVCA-----PDLDKRLD-IPVSPnSILGNVSPYFVERFSFSPDCKVAASTGDNPSALSGMLVGS-SWLT 298 fruit fly
15240526 227 IEKRCWSKAALEATA-----TGLEEKLG-KLAPAyATAGSISQYFVQRFGFEKNCVVVQWSGDNPNSLAGLTLSTpGDLA 300 thale cress
732210   218 IKTENWHKPLFDFIS-----SDLESKLG-TLVHPmTSTGHVHSYWTRRFGIPSDCTVLPFLGDNPSSLAGLSLLP-TDIG 290 Caenorhabditis elegans
18860918 224 IQDKVWSQACLGACA-----PHLEEKLS-PPVPScSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEE-GDIA 296 human
19075430 212 IQNEKFDIRLLEEVAgnskgPDLANKLGtVEINGaKHLGPIGKYFVKKYGFSPNCQIIPLTGDNPATILSLPLRPgKDVL 291 fission yeast
1723736  316 VSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDElnkerennyEKTNDWTLFNQaVLDDSE 395 baker's yeast
7296167  302 LSLDTSDVVVMPLKKAPRLEDGHVMCHPTRRDEYMGLLCFQNGGLTRKAICED---------VAGGSWRHFYE-MLDATP 371 fruit fly
7300206  299 ISMGTSDTLMMSLKEPLNWEEGHILCHPTETEEFMGLLCFRNASLVREEMNKK---------TTGGDWDKFNE-YLDSTP 368 fruit fly
15240526 301 ISLGTSDTVFGITKELQPSLEGHVLPNPVDPESYMVMLVYKNASLTREEIRDR---------CAEGSWDVFNK-YLQQTQ 370 thale cress
732210   291 ISLGTSDTVFFFTPTFEPNIDAHVFSHFAPNSGYMAMVCFKNGSLTRERARN----------LNNSSWDKWDK-IMKKTP 359 Caenorhabditis elegans
18860918 297 VSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNE---------SVSRSWSDFSK-ALQSTE 366 human
19075430 292 LSLGTSTTALMATQNYVCSPEYHMFAHPVTQNHYMVMLCYKNGSLAREQVRNTinek--ynvSDNTSWDRFNEsILNPNI 369 fission yeast
1723736  396 SSENEL---GVYFPLGEIVPSVKAINKRVIFNPKTGMIER-----EVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSN 467 baker's yeast
7296167  372 SGNNGNv--AVHFRDREIIP-TAKGTLRWDAHISPMSAECi---rGLHRFSTPEIEVRALIEGQIMHHWSIAHEMGFHHT 445 fruit fly
7300206  369 RGNFGNm--AVHFNDMEIIP-KAQGILRWNREMDPSSPDAa---rGVIKFSSPQIEIRALVEGQMLHHRAVAEDLGYKFG 442 fruit fly
15240526 371 PLNNGKl--GFYYTENEILPPLPVGSHRYILENFSGESLEgvkeqEVGEFD-PPSEVRALIEGQFLSKRAHTERFGMPS- 446 thale cress
732210   360 AGNDNYi--GFFFDEDEIVPRKPKGDYTFECSEEELKN----------KH--PEKFARAVFESQCLFKLLYTQKMGFKKS 425 Caenorhabditis elegans
18860918 367 MGNGGNl--GFYFDVMEITP-EIIGRHRFNTENHKVAA---------FPG---DVEVRALIEGQFMAKRIHAEGLGYRVM 431 human
19075430 370 KGAGEKkqlGLFYPQREILPAVGPGTWRFAIQGTELYQVDk----DEESWDYPDEDASAIVESQNLDIRMRITPLLTGIP 445 fission yeast
1723736  468 assqqrlnedtivkfdydesplrdylnkRPERTFFVGGASKNDAIVKKFAQVIGATKGNFrlETPNSCALGGCYKAMWSL 547 baker's yeast
7296167  446 ----------------------------PNTKIIVVGEDSRCQSVLQIVADIFNAPVYQR--TGVEVSLLGCAFRARYAF 495 fruit fly
7300206  443 ----------------------------PETQILVTGGASVNKSILQTIADVFNAPVHIQd-EGFEAALLGAAYRSAYAL 493 fruit fly
15240526 447 ----------------------------PPLRIIATGGASANENILSLISAIFGCDVYTV--QRPDSASLGAALRAAHGW 496 thale cress
732210   426 ----------------------------DCSRILVTGGASRNTVLLQILSDVFEMPVCTI--DVDGSAALGGAMRSRYGK 475 Caenorhabditis elegans
18860918 432 ----------------------------SKTKILATGGASHNREILQVLADVFDAPVYVI--DTANSACVGSAYR---AF 478 human
19075430 446 ----------------------------QPDRVYVVGGASRNEAIVFKISQVLGCDVYRLkhGGSNACAVGGAIKAAYAM 497 fission yeast
1723736  548 LYDSNKIA------VPFDKFLN-------DNFPWHvMESISDVDNE-NWDRYNSKIVPLSELEKTLI 600 baker's yeast
7296167  496 YEHRESACnchscmMPTGRRTRlsfdeffRDVPSG-LKLAAEPTPG-CDKIYKPLIERCSQICQLLA 560 fruit fly
7300206  494 YLQEAGDGv-----TPLCYRdy-----ilSLTSNK-LSLVCEPHKD-SEEIYAPMLQRYREMARVLS 548 fruit fly
15240526 497 LCNKKGSF------VPISNLYeg----klETTSLN-CKLKVKAGDAnIASTYGLLMKKRMEIENKLV 552 thale cress
732210   476 LKVIFNIFqs---kISVHSKTTkt---ysQYYPCDnVSLACQPISA-NVEVYSNLFKTFKSRFDEFI 535 Caenorhabditis elegans
18860918 479 HGLAGGTD------VPFSEVv--------KLAPN--PRLAATPSPG-ASQVYEALLPQYAKLEQRIL 528 human
19075430 498 NGKGFTFE-------EYVNK---------SWDESKkIELIMNKPSAqTYEEYGKLLPFLKKAEDIAI 548 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap