Conserved Protein Domain Family
KOG2485

?
KOG2485: KOG2485 
KOG2485, Conserved ATP/GTP binding protein [General function prediction only]
Statistics
?
PSSM-Id: 230424
View PSSM: KOG2485
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7487600    1 MVMMLKKTVKKGLIGGMSFAKDAGKINWFPGHMAAATRAIRNRLKLSDLVIEVRDARIPLSSANEDLQSQMS---AKRRI 77
gi 7300920    1 --------------------------------MTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITgsgVKPHI 48
gi 15236872   1 MATAKTWKIAREIGDAVIKASRNPNRRWYGPHMAAAVRAISERIPLVDFVLEIRDARIPLSSEYELLRKFSPl--PSKRI 78
gi 17556382     --------------------------------------------------------------------------------
gi 19112864   1 -----------MAFVARQTFEYQMPSTWYPGHMNKTLKRLKNLTSSNDIFVEVRDARIPLTSRNYVMEDFLN---KKNRI 66
gi 2497147    6 RGTRKIISNVSSFTPRYEFPKYSMPLTDFKGHQVKALKTFEKLLPQMNMIIELRDIRAPLSTRNVVFDRIARkehDVMKL 85
gi 13325182  24 LTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETLg---LKPHL 100
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7487600   78 IALNKKDLAN------PNVLNVIRFFKWT--RHFESSKQDCIAINAHSRSSVMKLLDLVELKLKEVIA-------REPTL 142
gi 7300920   49 LVLNKVDLLGa-----KQQKSVLQQLRRQqpELQHILFTNCKDQRNNGVLDILPLATRLVSESSRFNRt------QAAEH 117
gi 15236872  79 IVLNKMELADp-----LELKKCIDYFEER--NYLSYAVNSHNKDCVKQESPLFQILFIISEGLVLQIG---------SHP 142
gi 17556382   1 ----------------------MQKIAGK--CRNFPTKLQISRALN----DVKLSMLDALENTPRFNRt------VKTEY 46
gi 19112864  67 IVYNKCDLADtfhtkaKVSKHRIQNLAQQfqNVECWFKETSTPEKSAFITPYVSKAPYFAKELLRLIRtlvdqasANGRV 146
gi 2497147   86 VVYTRKDLMP------GNKPYIGKLKNWHeeLGEKFILLDCRNKTD--VRNLLKILEWQNYELETNGGy------LPMGY 151
gi 13325182 101 LVLNKMDLADl-----TEQQKIMQHLEGE--GLKNVIFTNCVKDEN--VKQIIPMVTELIGRSHRYHRk------ENLEY 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7487600  143 LVMVVGVPNVGKSALINsih-qiAAARFPVQERlKRATVGPLPGVTQDIAG-FKIAHRPS-----IYVLDSPGVLVP-SI 214
gi 7300920  118 NLMIIGVPNVGKSSVIN------VLRNVHLKKK-SAARVGAEAGITRSVGErIKIQENPP-----VYMIDTPGILQP-SI 184
gi 15236872 143 NVYVLDTPGIFPPNLYD------AEICAKLALT-GLISTKHKQNDYIPVKVlFLYSHSRI-----AQRAYWVGAIPD-DI 209
gi 17556382  47 QAMVVGIPNVGKSSLIN------AIRTHTLGIKrKAVEAGARPGVTVRVQNrVRILDKPP-----VYIIDTPGVLSP-NH 114
gi 19112864 147 YVYFVGMPNTGKSSILN------SLRNVALRKS-KSAIVGNYPGVTKRISEiVRLFNDMD-----VYMLDTPGIMTP-SI 213
gi 2497147  152 RALITGMPNVGKSTLINslrtifHNQVNMGRKFkKVAKTGAEAGVTRATSEvIRVTSRNTesrneIYLIDTPGIGVPgRV 231
gi 13325182 166 CIMVIGVPNVGKSSLIN------SLRRQHLRKG-KATRVGGEPGITRAVMSkIQVSERPL-----MFLLDTPGVLAP-RI 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7487600  215 PDIETGLKLALSGSVKDSVVGEERIAQYFLAILNIRGTPLHWKYLVEGINegphadCIDKPSYNLKDLRHQRTKQpdssa 294
gi 7300920  185 KDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSG------PSDDISAVLAEYAHREELF----- 253
gi 15236872 210 VGELKLARLFLTILNSSHEYKKWAKLCKSQDLTESLSDESSKSDAKHKRq------YATDHTQDFIVYDVRRVLY----- 278
gi 17556382 115 RNVEDAMKLAMCDLVLESHVNLYYLADFLLFWLNRSEDFSYLELLGINQK------FRKNSEKNEENLDFQIFWN----- 183
gi 19112864 214 TKPEDMLKLSLVGCVKEGIVHPVTVVDYLLFHLNRIDPSLYSKWSLPTN-------DVDEFLQNTAYKARKLTKG----- 281
gi 2497147  232 SDHNRMLGLALCGSVKNNLVDPIFQADYLLYLMNLQNLNDGRTELYPGSTn----sPTNDIYDVLRRLQVNKSQN----- 302
gi 13325182 233 ESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGS-------ACDNVERVLKSVAVKLGKT----- 300
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7487600  295 lhyvgdmisevqrslyITLSEFDGDTEdendleclieqqFEVLQKalkiphkaseARLMVSKKFLTLFRTGRLGPF-ILD 373
gi 7300920  254 ----------------HKVKQYDGR--------------VEVMT-----------NLLAAARKFIHFFRSGQLG---HMN 289
gi 15236872 279 ----------------ETISAFDGN--------------LEDEIS-----------MGNLIETQFAALRSVLRVPE-EAN 316
gi 17556382 184 ----------------FKFQNFKFPQK------------LDISPV----------TFlnwaenvnkyrisgnnltiehic 225
gi 19112864 282 ----------------GFDENFVSN--------------YVIQQY----------RIGRLGRFQLDTIDKNELLIR-LHN 320
gi 2497147  303 ----------------EKSTAIEWTNKwrl------hgkGIIFDPe---------VLLNNDEFSYKNYVNDQLEKLgDLS 351
gi 13325182 301 ----------------QKVKVLTGTGN------------VNVIQP----------NYPAAARDFLQTFRRGLLGSV-MLD 341
                       410
                ....*....|....
gi 7487600  374 DVPETETDHPNSKR 387
gi 7300920  290 LDEPSGFR------ 297
gi 15236872 317 YVIVMIYGLKNRCQ 330
gi 17556382 226 hsdmrkl------- 232
gi 19112864 321 EQNKKNAK------ 328
gi 2497147  352 YEGLSNKLKGNPNQ 365
gi 13325182 342 LDVLRGHPPAETLP 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap