Conserved Protein Domain Family
KOG2484

?
KOG2484: KOG2484 
KOG2484, GTPase [General function prediction only]
Statistics
?
PSSM-Id: 230423
View PSSM: KOG2484
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373   1 MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRKpRVEKDPGIPNDWPFKEQELKALEVRRARALEEIE- 79
gi 28381326   2 ALKRLKTKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGS-KKQKLIQIPNICPFKDDILKEVEEAKQRQEAERL- 79
gi 25407153   1 -----------MFAQLAPSPSPSPANVSHFVHRRTFRQCTYAVS---ASLPTANSSRPPPIQANIIVGGKDLNLDVTRK- 65
gi 17534827   2 AKYCLK-KTSKRVSCAKRYKIEKKVRDHNRKVKKEAKKNGTTN--KKEKTISVPNSCPFKEEILVQAEQEREKIKVRQE- 77
gi 19173359   4 HNQMWRSQQCTRLSPLLGVKVEGLMFRWSWIVCSYCIFPSACYLlVPRVDIPGMPKVVLPRNIKPKVGSPKMGIKKKRQs 83
gi 13376500     --------------------------------------------------------------------------------
gi 6457340    1 MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKQGHKK---PRKDPGVPNSAPFKEALLREAELRKQRLEELKQ- 76
gi 9506611    1 -------MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKA---TSKVPSAPHFVHPNDHANREAELKKKWVEEMRE- 69
gi 19113443   1 --MVSLKKKSKRRTTRLRSRIEKKAAESKRKQKRADKKNPQWKS-RIPKDPGIPNSFPYKDKILAEIEEQKRIREEEKl- 76
gi 731436     1 --MRVRKRQSRRTSTKLKEGIKKKASAHRKKEKKMAKKDVTWRS-RSKKDPGIPSNFPYKAKILEEIEAKKMKDLEEREl 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373  80 -------QKKEARK-------ERAKKRK----LGLVDDEDTKTEG-----ETIEDLP----------------KVVNVRD 120
gi 28381326  80 -------ARREAFK-------AEREQNKfktlESMVEDADMRSTVhgimhENDAQDQde-------------kKYKNAVT 132
gi 25407153  66 ---------------------DDSIGFKl---EANEDEIDWMNL------ESDIRLWt--------------rALRPVQW 101
gi 17534827  78 -------AAKEAAK-------IHRIEKRknnlPANFESMVAKASKqgtefDKKVASAae-------------hEKFNTLD 130
gi 19173359  84 -------KRLTTRKregmlkrARANERKkrrmDRKMQAKVERIPPsvlrtDEENMQYaeikrm----aklrkmEYDEALR 152
gi 13376500     --------------------------------------------------------------------------------
gi 6457340   77 -------QQKLDRQ-------KELEKKRk--lETNPDIKPSNVEPm----EKEFGLCk--------------tENKAKSG 122
gi 9506611   70 -------KQQAARE-------QERQKRRt--iESYCQDVLRRQEe----fEHKEEVLqe-------------lNMFPQLD 116
gi 19113443  77 -------ARRASGQvda--amEEEDAVDengsLMISKIAEAAQASn---pDDEEEFVmeednlgeapllvdseSYEASVK 144
gi 731436    78 akqqrleARKAAKEqgvdamdEDMIEDDenglAALVESAQQAAAEyegtpSNDADVRddeldvidynidfygeDVEGESE 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373 121 --NSERAFYKELVKVIELSDVILEVLDARDPLGTRCTDMERMVMQAGPN-KHLVLLLNKIDLVPREAAEKWLMYLREEFP 197
gi 28381326 133 keQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGN-KRLVLVLNKADLVPRENLNNWIKYFRRSGP 211
gi 25407153 102 ypGHIMKTEKELREQLKLMDVVIEVRDARIPLSTTHPKMDAWL----GN-RKRILVLNREDMISNDDRNDWARYFAKQGI 176
gi 17534827 131 d-KTIKAYASEVRKTVEIADVIIQVLDARDPLGSRSKSVEDQV--LKGG-KRLVLLLNKIDLVPRENVQKWLEYLRGQFP 206
gi 19173359 153 nsEKKEAYLDGILRLVSKSDVVIEVIDARDPDSSRNSEAEKIVS-EHG--KKLIMVLNYTQYVPREVVDEWKVHLKRDGN 229
gi 13376500   1 --------------------------------------MGEAILWAEGN-KKLVLVLKKIDLDPKEVVK-WLDYLRNELP 40
gi 6457340  123 kqNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQ--KKLVLILNKSDLVPKENLESWLNYLKKELP 200
gi 9506611  117 deATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGN-KKLVLVLNKIDLVPKEVVEKWLDYLRNELP 195
gi 19113443 145 adTSRKAYDKEFKKVVEASDVILYVLDARDPEGTRSKDVERQVLASSAEeKRLIFVINKIDLVPSEVLNKWVTYLRNFFP 224
gi 731436   158 leKSRKAYDKIFKSVIDASDVILYVLDARDPESTRSRKVEEAVLQSQG--KRLILILNKVDLIPPHVLEQWLNYLKSSFP 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373 198 AVAFKCSTQEQRSNlgwkss-kaskpSNMLQTSDCLGADTLIKLLKNYSRSHELKKSITVGIIGLPNVGKSSLINSLKRA 276
gi 28381326 212 VTAFKASTQDQANRlgrrkl-remktEKAMQGSVCIGAELLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRG 290
gi 25407153 177 KVIFTNGKLGMGA--------------MKLG--R-LAKSLAGDVNGKRREKGLLPRSVRAGIIGYPNVGKSSLINRLLKR 239
gi 17534827 207 TIAFKASTQEQKSNigrf----nsaiLNNTETSKCVGADIVMKILANYCRNKDIKTSIRVGVVGFPNVGKSSVINSLKRR 282
gi 19173359 230 DCIEVTEEDMRQI-----------------------GKETRIGIFGNPGSG---KNFVLRGISRILEEKPNSVVVSVPLS 283
gi 13376500  41 TVAFKARTQHQVS----------------------FGAENLMRVLGNYCCLGEMRTHIHMDIVGLPNIGKSSLIKSLKHS 98
gi 6457340  201 TVVFRASTKPKDKGkitkrv-kakknAAPFRSEVCFGKEGLWKLLGGFQET--CSKAIRVGVIGFPNVGKSSIINSLKQE 277
gi 9506611  196 TVAFKASTQHQVKNlnrcsvpvdqasESLLKSKACFGAENLMRVLGNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRS 275
gi 19113443 225 TIPMRSASGSGNSN------------LKHQSASASSTISNLLKSLKSYSAKKKLKSSLTVGVIGYPNVGKSSVINALVNR 292
gi 731436   236 TIPLRASSGAVNGT------------SFNRKLSQTTTASALLESLKTYSNNSNLKRSIVVGVIGYPNVGKSSVINALLAR 303
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373 277 HV------VNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSGNDa------SIALRNCKRIEKLDDPVSPVKEILKL 344
gi 28381326 291 RS------CMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENS-------HAVLKNAQRVGDVKDPFTIAESVLKR 357
gi 25407153 240 KI------CAAAPRPGVTREMKWVKLGKDLDLLDSPGMLPMRIDDQAa------AIKLAICDDIGEKAYDFTDVAGILVQ 307
gi 17534827 283 KA------CNVGNLPGITKEIQEVELDKNIRLIDSPGVILVSQKDLDp-----iEVALKNAIRVDNLLDPIAPVHAILRR 351
gi 19173359 284 KV-------------TLSSILRGCHGLMGIAFRDYIEAIVKRIDRGE--------VSLRHGIPEFSNAEELLESICDVHG 342
gi 13376500  99 HA------CSVGAIPGVTKFMQEVYLDKFIRLLDAPAIVPGPSSEVG--------TILHNCIHI---------------- 148
gi 6457340  278 QM------CNVGVSMGLTRSMQVVPLDKQITIIDSPSFIVSPLNSSS-------ALALRSPASIE-VVKPMEAASAILSQ 343
gi 9506611  276 RA------CSVGAVPGITKFMQEVYLDKFIRLLDAPGIVPGPNSEVG--------TILRNCVHVQKLADPVTPVETILQR 341
gi 19113443 293 SAngrsapCPAGNVAGMTTSLREVKLDNKLRLVDSPGIVFPSSDSKdd----lyRLVMLNAVSSTKVDDPVAVASYILQF 368
gi 731436   304 RGgqs-kaCPVGNEAGVTTSLREIKIDNKLKILDSPGICFPSENKKRskveheaELALLNALPAKHIVDPYPAVLMLVKR 382
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15231373 345 CPK-----DMLVTLYKIPSFE-------AVDDFLYKVATVRGKLKKGGLVDIDAAARIVLHDWNEGKIPYYTMPPKrdqg 412
gi 28381326 358 ASK-----EYFCTMYDITNYD-------TFEEFFAKKAARMGKFLKKGVPDVVAAARSVLNDWNTGKIKYCTQPPEvqeg 425
gi 25407153 308 MLAri-peVGAKALYNRYKIQ-------LEGNCGKKFVKTLGLNLFGGDS--HQAAFRILTDFRKGKFGYVSLERPpl-- 375
gi 17534827 352 CSK-----ETIMLHYNLADFN-------SVDQFLAQLARRIGKLRRGARPDVNAAAKRVLNDWNTGKLRYYTHPPEqgta 419
gi 19173359 343 IRD-----ESRSVCYMKASER-----------FLEDFLRHKILFWRRVYSDENDLSFAFCQ------------------- 387
gi 13376500     --------------------------------------------------------------------------------
gi 6457340  344 ADA-----RQVVLKYTVPGYR-------NSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTswtp 411
gi 9506611  342 CNL-----EEISNYYGVSGFQ-------TTEHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPAthtl 409
gi 19113443 369 LSRvpgqlERMFQRYELPPLLntsdidtAT-DFLVNIARKRGRLGRGGIPNLNAAANIVINDWHAGRIEWWAEP------ 441
gi 731436   383 LAKsdemtESFKKLYEIPPIPand-adtFTKHFLIHVARKRGRLGKGGIPNLASAGLSVLNDWRDGKILGWVLPNTsaaa 461
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 15231373 413 gh---aeskivTELAkdfNIDEVYSGESSFIGSLKtvNEFNPVII 454
gi 28381326 426 qsv-hisasivHSEArefDVENFESMETEILEHCAv-KTDDIMEI 468
gi 25407153     ---------------------------------------------
gi 17534827 420 kedivvpaevvSQFSkefDIDAIAEEQNQIVEGLPm-ESDIIAPH 463
gi 19173359     ---------------------------------------------
gi 13376500     ---------------------------------------------
gi 6457340  412 ppy--fnesivVDMKsgfNLEELEKNNAQSIRAIKgpHLANSILF 454
gi 9506611  410 pth--lsaeivKEMTevfDIEDTEQANEDTMECLAtgESDELLGD 452
gi 19113443 442 -----------EVIN---EKNSSEVQDTQIVTEWA--KEFDLNDF 470
gi 731436   462 sq---qdkqnlSTINtgtKQAPIAANESTIVSEWS--KEFDLDGL 501
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap