Conserved Protein Domain Family
KOG2361

?
KOG2361: KOG2361 
KOG2361, Predicted methyltransferase [General function prediction only]
Statistics
?
PSSM-Id: 230300
View PSSM: KOG2361
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18202486 361 VEWGEEQVQQAEEKIKEQFKHPVPEFDKKLYNENPARYWDIFYKNNKENF-FKDRKWLQIEFPILYASTRKDAEp---vT 436 baker's yeast
7292119    1 --------------------MEAEQKE--RFQTDAPKFWDSFYGIHDNRF-FKDRHWLFTEFPELAPLAADSAVlq-prS 56  fruit fly
25405754  39 QNLSKYLPDSQPWQDFHSRHSSGKFFKVLHTHHYSISCNQLLSFTIEEKFeLVERRYLLKEFPELVSCGENS-------K 111 thale cress
25407826  22 NVLNKTLKIFFRFFLREEEPERLTSTNTDKYERDAKKYWDIFYKHHGDRF-FKDRHYLDKEWNSYFSVSGKS-------V 93  thale cress
17557109   1 ------------------------------------MSDDGGFLSSQS-----SRELTEDDHEKLAKQKEIS-------- 31  Caenorhabditis elegans
17537435 105 VEWSPEQQEEAQRIVQGQKSMKVDEEKAMRLLSTPADQWDAFYAHNENRF-FKDRNWLLKEFPELNVEDESNLQke-kiE 182 Caenorhabditis elegans
13376117   1 MQWSKEEEAAARKKVKENSAVRVLLEEQVKYEREASKYWDTFYKIHKNKF-FKDRNWLLREFPEILPVDQKPEE------ 73  human
20479510     -------------------------------------------------------------------------------- human
8923005   40 PSQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQT-PPVEENVTQKISDLEICADEFPGssatyR 118 human
19113379  47 VEWDDEHLALAKKCIEEQKLYPVTEKD--AYMTHPERYWDQFYGKNEGKF-FMNRRWIAQEFPELLDLLKEDAGe---kS 120 fission yeast
19112556   1 ----------------MSGISKLSDFWVEKYKKESKKSWDKFYKRNETRF-FKDRHWLDREFDCYFGLPDKLPl-----T 58  fission yeast
18202486 437 IFEIGCGAGNTFFPILKDNENEN-LRIIAADFAPRAVELVKNSEQFNP---KYGHATVWDLANPDg-------------- 498 baker's yeast
7292119   57 IFELGCGVGNTILPLLQYSSEPQ-LKVFGCDFSARAIEILRSQRQFDE---KRCEVFVMDATLDH--------------- 117 fruit fly
25405754 112 LLEIGCGNGSTVLPILRGSKN---ITVYACDCSSDALVRTKENIDRAIssvDNFHSFCCDFSTSEfpdwvacdrcrdkfm 188 thale cress
25407826  94 ILEVGCGAGNTIFPLIATYPD---IFVYACDFSPRAVELVKAHDEYTE---TRVCAFACDLTGDG--------------- 152 thale cress
17557109  32 YLEAGCGVGNMLFPLVAEIPN---LKLFAFDFSDNAVKLLEERAKELE---LSVATSVVDLSIPS--------------- 90  Caenorhabditis elegans
17537435 183 ILEVGCGVGNTTFPLLQVNNSSSrLMLHSCDYAPNAIRVLKSQDAYDP---EKMNAFVWDITQPAs-------------- 245 Caenorhabditis elegans
13376117  74 -K-----ARESSWDHVKTSATNR-FSRMHCPTVPDEKNHYEKSSGSSEg-qSKTESDFSNLDSEKh-------------- 131 human
20479510     -------------------------------------------------------------------------------- human
8923005  119 ILEVGCGVGNTVFPILQTNNDPG-LFVYCCDFSSTAIELVQTNSEYDP---SRCFAFVHDLCDEEk-------------- 180 human
19113379 121 ILEIGCGAGNTIWPILKENKNSN-LKIFAVDYSEKAIDVVKQNPLYDA---KFCSASVWDLAGSD--------------- 181 fission yeast
19112556  59 ILEVGCGVGNLVYPLLEVQPN---LKIYCCDFSPRAIDFVKKHSCYNE---NRVFPFVNDITEDS--------------- 117 fission yeast
18202486 499 -----nLPDGVEPHSVDIAVMIFVFSALAPNQWDQAMDNLHKILK-PGGKIIFRDYGAYDLTQVRFK----KNRILEENF 568 baker's yeast
7292119  118 ------WQVPFEENSQDIIVMIFVLSAIEPKKMQRVLDNCYRYLR-PGGLLLFRDYGRYDLAQLRFK----SGKCMEDNF 186 fruit fly
25405754 189 lnhsggSESKHCIGGVDFVTLIFTLSAVPKERMPRAIKECFAVLK-PGGLLLFRDYGLYDMTMLRFE----PEKRVGFRE 263 thale cress
25407826 153 ------LDKHISPSSVDIVTMIFVLSAVSPEKMSSVLQNIRKVLK-PNGCILFRDYAVGDLAQERFSg---KDQRISENF 222 thale cress
17557109  91 -------VSSPFEEQVDLATLIFVLSAIHPEKHQISAENVRKMIK-IGGSVVVRDYGINDHAMIRFG----REARISDRF 158 Caenorhabditis elegans
17537435 246 -------QEAPNVGSLDYIVCIYVLSAIHPDNIKNALKNLVRLLK-PGGSLLLKDYGRYDLTQLRFK----KDRLIDGNL 313 Caenorhabditis elegans
13376117 132 ------KKGPMETGLFPGSNATFRILEVGCGAGNSVFPILNTLENsPESFLYCCDFASGAVELVKSHssyrATQCFAFVH 205 human
20479510   1 --------------------------------MMYVMMAYLTLFQ-MGSWMSFS----LSLCSLLFIl---TGHCLSENF 40  human
8923005  181 -------SYPVPKGSLDIIILIFVLSAIVPDKMQKAINRLSRLLK-PGGMVLLRDYGRYDMAQLRFK----KGQCLSGNF 248 human
19113379 182 ------LLRSIEEASIDAITLIFCFSALSPDQWQQAIENLYRLLK-PGGLILFRDYGRLDLTQLRAK----KNRILSENF 250 fission yeast
19112556 118 ------LLEVLGSACIDTLTAIFVLSAIPREKQLRSIKNLASVIK-PGGHLVFRDYCDGDFAQEKFMts-gDPSMIDEQT 189 fission yeast
18202486 569 YVRGDGTRVYFFSEEKLREIFTKKYFLENKIGTDRRLLVNRKRQLKMYRCWVQAVFDVPQ 628 baker's yeast
7292119  187 YVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDRRLQVNRCRGLKMYRVWIQTKFRKPL 246 fruit fly
25405754 264 YVRSDGTLSYFFCLDTARKLFTDAGFIEVELEYCCVKAVNRRKGKDMYRVWVHGKFQKPF 323 thale cress
25407826 223 YVRGDGTRAFYFSNEFLETLFSEQGFEVEELDVCCKQVENRSRELVMNRRWVQATFRRTN 282 thale cress
17557109 159 YVRQDGTRAYYFDLNELSEVFEKSGFRCVRKEYLHRMTVNHQKGLKAPRIFVQARFIRES 218 Caenorhabditis elegans
17537435 314 YCRGDGTLVYFFDMEEL-----------------ETLLAEHGLQKKVMHVDRRLIVNRAK 356 Caenorhabditis elegans
13376117 206 DVCDDGLP-YPFPDGILD----------------VILLVFVLSSIHPDRTLFI------- 241 human
20479510  41 YVRGDGTRAYFFTKGEVHSMFCKASLDEKQNPVDCHLRVNRKKQVKMHRVWVQGKFQKPL 100 human
8923005  249 YVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRLQVNRGKQLTMYRVWIQCKYCKPL 308 human
19113379 251 YIRGDGT---------------------------RVLIVNRKKRVKMYRCWLQAKFQK-- 281 fission yeast
19112556 190 FVRQDGTLSLFFREEDIAEWMKSAGFGLVTLDRVNRTVDNRKRNLNMKRTFLQGVWKKL- 248 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap