Conserved Protein Domain Family
KOG2310

?
KOG2310: KOG2310 
KOG2310, DNA repair exonuclease MRE11 [Replication, recombination and repair]
Statistics
?
PSSM-Id: 230249
View PSSM: KOG2310
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17562716   1 MSatgkvsrpiqvftranyffklifqfkvrkynsltverifiramcgSDDSFDDFvpdsqepassrtrnqdhldddevpc 80  Caenorhabditis elegans
7297844    1 MNg--------------------------------------------TTTAEQDA------------------------- 11  fruit fly
17380154   1 MS-------------------------------------------------REDF------------------------- 6   thale cress
19173668     --------------------------------------------------------------------------------     Encephalitozoon cun...
17380137   1 MS---------------------------------------------TADALDD-------------------------- 9   human
17380137   1 MS---------------------------------------------TADALDD-------------------------- 9   human
1172822    1 MPn-------------------------------------------dPSDMNNELh------------------------ 13  fission yeast
1709096    1 MD-------------------------------------------------YPD-------------------------- 5   baker's yeast
17562716  81 sqrpdaandtmvedldegdepahdesEDIIKILVATDIHCGYGENKANIHMDAVNTFEEVLQIATEQKVDMILLGGDLFH 160 Caenorhabditis elegans
7297844   12 --------------------------DNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLGGDLFH 65  fruit fly
17380154   7 --------------------------SDTLRVLVATDCHLGYMEKDEIRRHDSFKAFEEICSIAEEKQVDFLLLGGDLFH 60  thale cress
19173668   1 -----------------------------MKILITSDNHLGYRESDPVLLDDSYDTFEEILGIAQRERVDLVLQGGDLFH 51  Encephalitozoon cun...
17380137  10 --------------------------ENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFH 63  human
17380137  10 --------------------------ENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFH 63  human
1172822   14 -------------------------nENTIRILISSDPHVGYGEKDPVRGNDSFVSFNEILEIARERDVDMILLGGDIFH 68  fission yeast
1709096    6 --------------------------PDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDMVVQSGDLFH 59  baker's yeast
17562716 161 ENNPSREVQHRVTQLLRQYCLNGNPIALEFLSDASVNFNQSVFGHVNYYDQNLNVGLPIFTIHGNHDDLSGKG-LTALDL 239 Caenorhabditis elegans
7297844   66 DAVPSQNALHKCIELLRRYTFGDRPVSLEILSDQGQCFHNAVNQSVNYEDPNLNIAIPVFSIHGNHDDPSGFGrLSSLDL 145 fruit fly
17380154  61 ENKPSRTTLVKAIEILRRHCLNDKPVQFQVVSDQTVNFQNA-FGQVNYEDPHFNVGLPVFSIHGNHDDPAGVDnLSAIDI 139 thale cress
19173668  52 ENRPSRSCLNRTIGLFRRYCIGNERSGLRSN------------LALNFHDQNIGISIPVVSIHGNHDDPSGISmVSPIDI 119 Encephalitozoon cun...
17380137  64 ENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADaLCALDI 143 human
17380137  64 ENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADaLCALDI 143 human
1172822   69 DNKPSRKALYQALRSLRLNCLGDKPCELELLSDTSLTTGDTAVCNINYLDPNINVAIPVFSIHGNHDDPSGDGrYSALDI 148 fission yeast
1709096   60 VNKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYDEFTNVNYEDPNFNISIPVFGISGNHDDASGDSlLCPMDI 139 baker's yeast
17562716 240 LHESGLVNLFGK----HSNIQEFIVSPILLRKGETRLALYGIGSQRDDRLVRAFKN-NSISFLRPNAG-----------A 303 Caenorhabditis elegans
7297844  146 LSTSGLVNYFGR----WTDLTQVEISPVLMRKGESQLALYGLSHIHDGRLARLIKD-FKVKFNCPENVangedgneskeE 220 fruit fly
17380154 140 LSACNLVNYFGKmvlgGSGVGQITLYPILMKKGSTTVALYGLGNIRDERLNRMFQTpHAVQWMRPEVQeg-------cdV 212 thale cress
19173668 120 LQSAGLVNYIGK----YNLIDRIDVYPLLLEK-EYRVAIYGLGHIKDRRLYRMFCE-GRIVFHRPEDY------------ 181 Encephalitozoon cun...
17380137 144 LSCAGFVNHFGR----SMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVN-KKVTMLRPKe-----------dE 207 human
17380137 144 LSCAGFVNHFGR----SMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVN-KKVTMLRPKe-----------dE 207 human
1172822  149 LQVTGLVNYFGR----VPENDNIVVSPILLQKGFTKLALYGISNVRDERLYHSFRE-NKVKFLRPDLYr----------- 212 fission yeast
1709096  140 LHATGLINHFGK----VIESDKIKVVPLLFQKGSTKLALYGLAAVRDERLFRTFKD-GGVTFEVPTMR-----------E 203 baker's yeast
17562716 304 EDWFNLFVLHQNRprrAMHRSTgNFLPESLIPQFFDLLIWGHEHECKPDPQYVASseavgDGFYILQPGSTVATSLTPEE 383 Caenorhabditis elegans
7297844  221 EDWFHLLVVHQNR---ADRGPK-NYLPEDLLPSFLHLVIWGHEHDCRIEPEENAK-----KRFYVSQPGSSVPTSLSEGE 291 fruit fly
17380154 213 SDWFNILVLHQNR---VKSNPK-NAISEHFLPRFLDFIVWGHEHECLIDPQEVSG-----MGFHITQPGSSVATSLIDGE 283 thale cress
19173668 182 DSWYNVLILHQNR----IPREK-EHFSSDLVEGFFDLIVYGHEHESMVVKGDCLI----------LQPGSTVRTSLCEGE 246 Encephalitozoon cun...
17380137 208 NSWFNLFVIHQNR---SKHGST-NFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQ-----QLFYISQPGSSVVTSLSPGE 278 human
17380137 208 NSWFNLFVIHQNR---SKHGST-NFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQ-----QLFYISQPGSSVVTSLSPGE 278 human
1172822  213 DEWFNLLTVHQNH---SAHTPT-SYLPESFIQDFYDFVLWGHEHECLIDGSYNPT-----QKFTVVQPGSTIATSLSPGE 283 fission yeast
1709096  204 GEWFNLMCVHQNH---TGHTNT-AFLPEQFLPDFLDMVIWGHEHECIPNLVHNPI-----KNFDVLQPGSSVATSLCEAE 274 baker's yeast
17562716 384 ALQKNAFLIKIK-GRKFASKPIPLQTVRPMVCDELLLDKIPPGsrpiLKTDRPKHTDGryIDEIAIEaKINEMITTA--- 459 Caenorhabditis elegans
7297844  292 AKKKHVGLLEIY-KGKFKLKPLPLETVRPFVYESVVLADHADE----LGLVEGDASTK--VFKFAQE-RVEAMIERA--- 360 fruit fly
17380154 284 SKPKHVLLLEIK-GNQYRPTKIPLTSVRPFEYTEIVLKDESD--------IDPNDQNS--ILEHLDK-VVRNLIEKA--- 348 thale cress
19173668 247 RHDKYAYILRIG--EECTLEHVKLRSVRPLLLDTLRIEERDNVeekvENKIRGMIDLGrkKESLFNKeITAIDVDTKrfk 324 Encephalitozoon cun...
17380137 279 AVKKHVGLLRIK-GRKMNMHKIPLHTVRQFFMEDIVLANHPDI----FNPDNPKVTQA--IQSFCLE-KIEEMLENA--- 347 human
17380137 279 AVKKHVGLLRIK-GRKMNMHKIPLHTVRQFFMEDIVLANHPDI----FNPDNPKVTQA--IQSFCLE-KIEEMLENA--- 347 human
1172822  284 TAPKHCGILNIT-GKDFHLEKIRLRTVRPFIMKDIILSEVSS--------IPPMVENKkeVLTYLIS-KVEEAITEA--- 350 fission yeast
1709096  275 AQPKYVFILDIKyGEAPKMTPIPLETIRTFKMKSISLQDVPH--------LRPHDKDA--TSKYLIE-QVEEMIRDAnee 343 baker's yeast
17562716 460 KAKRRPRQ---------------PELPLIRLKVIYDGDwl-----nITPANAKRIGLRYENVVANAVDMVFIKKNNKpke 519 Caenorhabditis elegans
7297844  361 VAQHTGHPk-------------qPTLPLIRLRLLYTDE--------SCMFNAIRFGEMLSTRVANVQDVVQFSKVVK--- 416 fruit fly
17380154 349 SKKAVNRSe--------------IKLPLVRIKVDYSG---------FMTINPQRFGQKYVGKVANPQDILIFSKASK--- 402 thale cress
19173668 325 CRGDSNEAcgagpvckgyqleekTRIPLVKLKIELCGD---------EVLDKHRFSAQFKGLVANPSDMLTISRKTR--- 392 Encephalitozoon cun...
17380137 348 ERERLGNSh-------------qPEKPLVRLRVDYSGG--------FEPFSVLRFSQKFVDRVANPKDIIHFFRHREq-- 404 human
17380137 348 ERERLGNSh-------------qPEKPLVRLRVDYSGG--------FEPFSVLRFSQKFVDRVANPKDIIHFFRHREq-- 404 human
1172822  351 NAQWYEAQgtvpv-----venekPPLPLIRLRVDYTGG--------YQTENPQRFSNRFVGRVANATDVVQFYLKKK--- 414 fission yeast
1709096  344 TKQKLADDgegd-------mvaeLPKPLIRLRVDYSAPsntqspidYQVENPRRFSNRFVGRVANGNNVVQFYKKRSp-- 414 baker's yeast
17562716 520 gKLQT-ENEKNITEMADe------MGQVSATNLQTIINDYfiNQPLVDQMTVLKPIGIGRALEQYSAIEEgglaTSAnrn 592 Caenorhabditis elegans
7297844  417 -RTKT-EAVNLDKEALRr-----aLEADNATRVEELVDRYfeEAKSNKPLKLFHSKALAEMTYRLLEQRD----ADA--- 482 fruit fly
17380154 403 -KGRS-EANIDDSERLR-------PEELNQQNIEALV------AESNLKMEILPVNDLDVALHNFVNKDD----KLA--- 460 thale cress
19173668 393 ---RR-EEVETQPMAER--------VEISQILRKILG---------NVEFGVLSRLGFSESLDEFVKGDS-----NA--- 443 Encephalitozoon cun...
17380137 405 -KEKTgEEINFGKLITK-------PSEGTTLRVEDLVKQYfqTAEKNVQLSLLTERGMGEAVQEFVDKEE----KDA--- 469 human
17380137 405 -KEKTgEEINFGKLITK-------PSEGTTLRVEDLVKQYfqTAEKNVQLSLLTERGMGEAVQEFVDKEE----KDA--- 469 human
1172822  415 -YTRSkRNDGLYTSAVE-------DIKINSLRVESLVNEY---LKTN-RLECLPEDSLGEAVVNFVEKDD----RDA--- 475 fission yeast
1709096  415 -VTRSkKSGINGTSISDrdveklfSESGGELEVQTLVN----DLLNKMQLSLLPEVGLNEAVKKFVDKDE----KTA--- 482 baker's yeast
17562716 593 FDSCLMHQIDVVrktlk-kmplPPINDPSDLDKFRDLITKDLYDMKKADSERFKNP-VADVEMEEDEDDPQYymppQSTS 670 Caenorhabditis elegans
7297844  483 AENIVKFYKEKA----------VDHLMEAMPN--DENIDEELERF-RALHKHG-------DLLKMLDTQG------LKVK 536 fruit fly
17380154 461 FYSCVQYNLQETrgklakdsdaKKFEEDDLILKVGECLEERLKD--RSTRPTGSSQfLSTGLTSENLTKGSSgianASFS 538 thale cress
19173668 444 FMGMVRKNIEKV------------VNAVDHSSIVDEDVIKAMKRASREEDRGYEEDhFEPRAALGVLDEMDP-----GLA 506 Encephalitozoon cun...
17380137 470 IEELVKYQLEKT----------QRFLKERHIDALEDKIDEEVRRF-RETRQKNTN--EEDDEVREAMTRARA----LRSQ 532 human
17380137 470 IEELVKYQLEKT----------QRFLKERHIDALEDKIDEEVRRF-RETRQKNTN--EEDDEVREAMTRARA----LRSQ 532 human
1172822  476 IKECVETQLNKQ----------INLLVKKRVT--EENLEQEISSIINDLPKISTTKrKDYEELPEEVSETS-----INIA 538 fission yeast
1709096  483 LKEFISHEISNEvg-------iLSTNEEFLRTDDAEEMKALIKQVKRANSVRPTPP-KENDETNFAFNGNGLd--sFRSS 552 baker's yeast
17562716 671 RTNYASGSEDEVANSDEEMGSSISR-----HSKQPTT-RGRGRGA---RG------AGASRETT---------------- 719 Caenorhabditis elegans
7297844  537 KEEKS--------MSV--LGSEV-N-----VSTAPATgRGAARG----R--------GTARTRAg--------------- 573 fruit fly
17380154 539 DDEDTTQMSGLAPPTRGRRGSSTANtt-rgRAKAPTRgRGRGKASsamKQttldssLGFRQSQRsasa------------ 605 thale cress
19173668 507 NKNLRNEYSSRLGGNSEENESKAKKnf--nVEDLLGKeYLSKKLRkdkEDsstdvsFTFSKYL----------------- 567 Encephalitozoon cun...
17380137 533 SEESASAFSADDLMSID-LAEQMANdsddsISAATNKgRGRGRGRrggRGqnsasrGGSQRGRAdtgletstrsrnskta 611 human
17380137 533 SEESASAFSADDLMSID-LAEQMANdsddsISAATNKgRGRGRGRrggRGqnsasrGGSQRGRadtgletstrsrnskta 611 human
1172822  539 EHTPVLKHTSSLLDHHSPLATSSSEh---eMEATPSPaLLKKTNKr--RElp--ssLTKKNTRTp--------------- 596 fission yeast
1709096  553 NREVRTG-SPDITQSHVDNESRITHis-qaESSKPTSkPKRVRTAtkkKIpafsdsTVISDAENe--------------- 615 baker's yeast
17562716 720 -----------RGRSNKVVSTRQID----S--------D------Gf--EIINDSPSPPPASr---------STRGKARG 759 Caenorhabditis elegans
7297844  574 -----------ATAATRGKGQLDVTv---S-------------------STRTSGRQQTLLS----------SLMGSRNT 610 fruit fly
17380154 606 -------aasaAFKSASTIGEDDVDsp-sSeevepedfNkpdsssEddeSTKGKGRKRPATTkrgrgrgsgtSKRGRKNE 677 thale cress
19173668     --------------------------------------------------------------------------------     Encephalitozoon cun...
17380137 612 vsasrnmsiidAFKSTRQQPSRNVTtknySevievdesDveedifPt--TSKTDQRWSSTSS----------SKIMSQSQ 679 human
17380137 612 vsasrnmsiidAFKSTRQQPSRNVTtknySevievdesDveedifPt--TSKTDQRWSSTSS----------SKIMSQSQ 679 human
1172822  597 ----------qRSKEVKKVPARKLSq---S-------------------TKKSDKNTQSTLL----------FYDPSSTT 634 fission yeast
1709096  616 -----------LGDNNDAQDDVDIDe---Ndiim-vstDeedasyGllnGRKTKTKTRPAAS----------TKTASRRG 670 baker's yeast
17562716 760 KSAPSK-------------KRDLSFF 772 Caenorhabditis elegans
7297844  611 ASYVISd------------DSD---- 620 fruit fly
17380154 678 SSSSLNrllsskdddededDEDREKK 703 thale cress
19173668     --------------------------     Encephalitozoon cuniculi
17380137 680 VSKGVDfes-------sedDDDDPFM 698 human
17380137 680 VSKGVDfes-------sedDDDDPFM 698 human
1172822  635 EAQYLD-------------NEDDEIL 647 fission yeast
1709096  671 KGRASR-------------TPKTDIL 683 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap