Conserved Protein Domain Family
KOG2270

?
KOG2270: KOG2270 
KOG2270, Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms, Cell cycle control, cell division, chromosome partitioning]
Statistics
?
PSSM-Id: 230209
View PSSM: KOG2270
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7294696   27 FKNLTLKHEI-FKDIKLTPKEDcddlaqviatanEEDEPEDEEPEEYDEDDyddigDDYDtyeEAYTGFNKLHVQpqltn 105 fruit fly
15224659  11 PPTIPPVVEY-EEEHDDDDDDD------------LSLSSDSDIAEALDWLDg----KDDD---ELIGGGFSLHARrpn-a 69  thale cress
7505857    1 MEKVEHLNLNiQNILEDVDIDT------------ASSSSDDEPEQAVVKQE-------Kl---EAGEQIEEQYDT----- 53  Caenorhabditis elegans
19173647     --------------------------------------------------------------------------------     Encephalitozoon cun...
23510356  29 LKTVKEKDDIlFEDLQDNVNEn------------GEGEIEDEEEEGYDDDD-----DDWDw-dEGVGKLAKGYVW----- 85  human
19114173   1 -----MVEEL-KNDAQTNEEESe-----------YSDFSDGSDNDYFREDD-----IDWN---QASSNYSARQEN----- 50  fission yeast
2500508      --------------------------------------------------------------------------------     baker's yeast
7294696  106 asGGGSGGGAGGASGGSQRVSSYQPNEKL--LRRYSARInveKYDPTTNMSAQAANRLVNFDrRDRTQVRDKHDRATAEQ 183 fruit fly
15224659  70 hgGHGSRPNSSSLQPISNKAQKLTSHVRAspLEGWEGRV---KVGMSNSVTTAIRGSLRDTE-IGRSRNTDKADRATVEQ 145 thale cress
7505857   54 --DSDYDDDIVEFAEATGDFTKKLNAARLntIGPNAARN------RLTVDVERHADTSEDRK---RKRVKDRADRATVEQ 122 Caenorhabditis elegans
19173647   1 -------------------------------MQVYANLL------TTGRCKVRSFYPWKMKEtRAEKRKKDKSDRATVDK 43  Encephalitozoon cun...
23510356  86 --NGGSNPQANRQTSDSSSAKMSTPADKV--LRKFENKInldKLNVTDSVINKVTEKSRQKE-ADMYRIKDKADRATVEQ 160 human
19114173  51 --FGNNSSKINSVNDHVSTLSRYVNNIKLn--DRFEAEGf-rTRGLLILHTFTFSCLIVLTN-KDKSSIKDKSDRATSEQ 124 fission yeast
2500508    1 ---MSLEDKFDSLS-VSQGASDHINNQLL---EKYSHKI----------KTDELSFSRAKTS-------KDKANRATVEN 56  baker's yeast
7294696  184 VMDPRTRMILFKLLNRGMIQEINGCISTGKEANVYH-------------------AVSKNGEEe----FAIKIYKTSILV 240 fruit fly
15224659 146 ALDPRTRMVLFRMLNRGVFNDVNGCISTGKEANVYH-------------------ATKSDGSE-----LAIKVYKTSVLV 201 thale cress
7505857  123 VLDPRTRLVLFRLLQRGTLLNIDGCISTGKEANVYH-------------------ATGTDNDL------AIKIYKTSILT 177 Caenorhabditis elegans
19173647  44 VLDKRTLKVLERLQARGKLVNLQGSLCTGKESNVYLgeastslcs--kfiknrysVTEEPGREgqivpVVVKIFKTSIMS 121 Encephalitozoon cun...
23510356 161 VLDPRTRMILFKMLTRGIITEINGCISTGKEANVYH-------------------ASTANGES-----RAIKIYKTSILV 216 human
19114173 125 VLDPRTRMILLKLINNGTISEINGCISTGKEANVYH-------------------ATNEDGKH-----FAIKIYKTSILV 180 fission yeast
2500508   57 VLDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHafagtgkapvideetgqyeVLETDGSRa---eYAIKIYKTSILV 133 baker's yeast
7294696  241 FKDRDKYVSGEFRFRHGYCKHNPRKMVRTWAEKEMRNYLRMRNAG-VPVPEPILLRSHVLVMRFCG-RDGWPAPKLKDVE 318 fruit fly
15224659 202 FKDRDRYVQGDYRFRYGYCRHNPRKMVKTWAEKEQRNLKRLHAAG-IRCPAVILLRLHVLVMEFIG-RDGWAAPRLKDAA 279 thale cress
7505857  178 FKDRERYVTGEFRYRHGYCKSNPRKMVAVWAEKEMRNLARMHEVG-LPVPKPHLLKGHVLVMDFLG-KDGWPAPLLKNAN 255 Caenorhabditis elegans
19173647 122 FRDRERYIRSEKRFQR-FCTSNSRKLIKVWAEKEVRNLKRLNNAG-IPSPEPIYLKNNILVMTQIG-RCSEVAPRLRDAS 198 Encephalitozoon cun...
23510356 217 FKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAE-IPCPEPIMLRSHVLVMSFIG-KDDMPAPLLKNVQ 294 human
19114173 181 FKDRDRYVSGEFRFRHGYNKRNPRKMVRLWAEKEIRNLKRVAAAG-IPCPEPILLKQHVLLMSFLGdKKGWAYPKLKDID 259 fission yeast
2500508  134 FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGvIPAPKPIEVKNNVLVMEFLSrGNGFASPKLKDYP 213 baker's yeast
7294696  319 LS-------------------------------------TSK-----ARELYRDCVVIMWRIYNQCRLVHADLSEFNILL 356 fruit fly
15224659 280 LS-------------------------------------LDK-----LRECYLELIIQMRVLYQKCKLVHGDLSEYNILY 317 thale cress
7505857  256 LSqevaiskfyqffvfffdeknknlqnfylkkknvilskTSKkpkkdAEPMYVGLVRDMRRLYRECKLVHADLSEFNMLV 335 Caenorhabditis elegans
19173647 199 IK---------------------------------------D-----LEGCYQQCVKIIRDMYKKAGLVHADLSEFNLLY 234 Encephalitozoon cun...
23510356 295 LS-------------------------------------ESK-----ARELYLQVIQYMRRMYQDARLVHADLSEFNMLY 332 human
19114173 260 MT-------------------------------------PGE-----ATKLYQLVARNMRILFHVCHLVHADLSEYNLLY 297 fission yeast
2500508  214 YKn------------------------------------RDE-----IFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIV 252 baker's yeast
7294696  357 QDGQLVIIDVSQSVEHDHPHSFDFLRKDCTNISEFFRKRAVATMTVKELFDFITDQTITTENMEEC-LERISERIKDRDf 435 fruit fly
15224659 318 FEGHLYIIDVSQSVDLDHPLALNFLREDCDHVSDFFKKHGVAVMTIRELFDFIVDPAITDENVDSY-LEEVQRKVIERG- 395 thale cress
7505857  336 HDGKLWIIDVSQSVEQDHPHALEFLRMDCNNVNKFFRELGVPVLSVRRLFEVIVDPLMSSKEMETI-IEEERVLVNSED- 413 Caenorhabditis elegans
19173647 235 FEGVVYVIDVGQSVEIDHDNAQRFLIMDINNINSFFSRKGVSVAKGNDLFEEISGNVIPLY---------LKDIDIGRD- 304 Encephalitozoon cun...
23510356 333 HGGGVYIIDVSQSVEHDHPHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAY-LSKAMEIASQRTk 411 human
19114173 298 HKGKVYFIDVSQSVEHDHPQSIDFLRMDILNISTFFRRLNAGCLSLPQLFKFITEEGSCEK--EAM-KTRLNAIYEEEP- 373 fission yeast
2500508  253 HDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNnISALVAYIASNLp 332 baker's yeast
7294696  436 dAISAQEKIDEAVWQNTYIPKRLDEVRHFERD---VAKAKQG------VQQNLIYGKITGLT--SDLDVQQKPDVLQSST 504 fruit fly
15224659 396 -EISVEDEIADSVFMKSYIPKSLDAVNNPEAD---VAKITSGq-----DTGDMLYQTITGLK--DALPKIEEQKIEVNDE 464 thale cress
7505857  414 ----------DSLFMNAFIPHKLEHVLHFERD----GKLAKEg----vEANNPFQNIVSKIDlkGDGFGEEHDDSDDNDD 475 Caenorhabditis elegans
19173647 305 ----------------AFIPSRVSEVGNEEDL----LAFAADs-----RSREFGSTTDSDLS------------STGEAS 347 Encephalitozoon cun...
23510356 412 eERSSQDHVDEEVFKRAYIPRTLNEVKNYERDmdiIMKLKEEdmamnaQQDNILYQTVTGLK--KDLSGVQKVPALLENQ 489 human
19114173 374 ---TTEEYEEE--FLKTYVPRTLDEVYDIDRDteiVNAGGVNs----lVYKHLLNTDFQKLDl-NDTTKNQNDQILPNET 443 fission yeast
2500508  333 iKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDrytDGKFDLLks---lIAHDNERNFAASEQfeFDNADHECSSGTEEFS 409 baker's yeast
7294696  505 AKEDDGS-EAQTSGSEDEDNSQDNDNDEDAKKFKNSARPreespesKKARKKAVKDAKAEQRKVKVKKHVKKRKEKMGSM 583 fruit fly
15224659 465 EKEEEGE-E-EEDGESEEGSEEEESEEELGHEDKKAARK---------EHKKKVKEEKRESRKTKTPKSVKKRKKKVSKP 533 thale cress
7505857  476 EENGKKSrKKRAEPTEEEIQEKERKIAMHTRNREETAEE-------RKERKAAVKEEKREQRKEKIPKHLKKRAHRQHMK 548 Caenorhabditis elegans
19173647 348 VEDSD-----ASLGATESR--GGGNIREEKKRKKKTVKEl------NRIRRASRISKKEKKRIFKRYIGMKKRKN----- 409 Encephalitozoon cun...
23510356 490 VEERTCS-DSEDIGSSECSDTDSEEQGDHARPKKHTTDPdi----dKKERKKMVKEAQREKRKNKIPKHVKKRKEKTAKT 564 human
19114173 444 SESDD---DANSISSMENEEERTSDSKSSAKQGKGNGRAket-peeKRARKKKTKEDKAEKRKSKIPKYEKKRKLKQSGR 519 fission yeast
2500508  410 DDEEDGS-SGSEEDDEEEGEYYDDDEPKVLKGKKHEDKDl------KKLRKQEAKDAKREKRKTKVKKHIKKKLVKKTKS 482 baker's yeast
7294696  584 KK 585 fruit fly
15224659 534 HK 535 thale cress
7505857      --     Caenorhabditis elegans
19173647     --     Encephalitozoon cuniculi
23510356 565 KK 566 human
19114173 520 KK 521 fission yeast
2500508  483 KK 484 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap