Conserved Protein Domain Family
KOG2187

?
KOG2187: KOG2187 
KOG2187, tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 230126
View PSSM: KOG2187
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
464650    46 KSIFKARFFACRN-FVKKHNYKLISTMTGSTEMVPPTMKHTVDNKRLSSpLTDSGNRRTKKPKLRKYKAKKVETTSPMGV 124 baker's yeast
25407988 143 vlfteqmmesidgdeggggsvsvvdlslskclvhlpnkwqsdelkkflgeqgvlyksakkrrgmivgfvtfenaeqlqsg 222 thale cress
15232519  51 AHGLRYVVVPTRSwLHRFRCCSSSLAPLSPSEFSGGNKAQKKLNDENNT-NVSNEKTAPYYPKRGETVELVCESLGFKGK 129 thale cress
17561946   1 MADPVDIKTETPElTPEVKEEKAIDLDRIHIKNIPTFIGFKQFKKVLEK-ILGDVKSK-KVRHMSDYAYVTFETPEDAQK 78  Caenorhabditis elegans
20149688   1 --------------------------------------MAGLKRRVPLH-SLRYFISMVGLFSKPGLLPWYARNPPGWS- 40  human
21361612  47 AGAATGPGPQPGLySYIRDDLFTSEIFKLELQNVPRHASFSDVRRFLG--RFGLQPHKTKLFGQPPCAFVTFRSAAERDK 124 human
23270682  33 egagaatgpgpqpglysyirddlftseifklelqnvprhasfsdvrrflgrfglqphktklfgqppcafvtfrsaaerdk 112 human
1351598    1 ---------------MYPYCLKYLTNGLRSKQMINFLCIQNILSARTLK-ICRFRFLPTPSHPTHKMAQETRAISSISEA 64  fission yeast
464650   125 LEFEVNDLLKSQNLSREQVLNDVTSILNDKS---STDGPIVLQYHREV-KNVKVLEITSNGNGLALIDNPVETEKKQVVI 200 baker's yeast
25407988 223 vermlyrnvfnvlqildgktvnssnlkiadvlprtfdkndarKSVKSArDAVTPLAYLSYADQLEQKKTSIGQMLKKLVR 302 thale cress
15232519 130 GICKVDGTGYVVMCDRALPGERFLGRVTRRKg-sYAEVTKMKTISPHKdLVEAPCEYASYCGGCKTQNLSYEAQLRAKEE 208 thale cress
17561946  79 AINLVDGYDYKKFILSAQLAATEVKSFRPAN-----PENTEPAQQKTArESVTPLAEMEYGKQLELKQQNSVGVVEKLYR 153 Caenorhabditis elegans
20149688  41 --QLFLGTVCKGDFTRVIATKCQKGQKSQKKp--SHLGPLDGSWQERLaDVVTPLWRLSYEEQLKVKFAAQKKILQRLES 116 human
21361612 125 ALRVLHGALWKGRPLSVRLARPKADPMARRR---RQEGESEPPVTRVA-DVVTPLWTVPYAEQLERKQLECEQVLQKLAK 200 human
23270682 113 alrvlhgalwkgrplsvrlarpkadpMARRR---RQEGESEPPVTRVA-DVVTPLWTVPYAEQLERKQLECEQVLQKLAK 188 human
1351598   65 ANKRARKLSKRRAKKPVEEGSSGHVLLLEIEnliEKPVLANVPFERFQeIEVKISYLSSSGDGIGLVCNDQYAVVVPFTL 144 fission yeast
464650   201 ipfgLPGDVVNIKVFKTHPYYVESD-----LLDVVEKSPMRRDDLIRDKYFGKss----gsQLEFLTYDDQLELKRKTIM 271 baker's yeast
25407988 303 sfvfLFELVRGMRVKLVQMGIHFHNgslhrETEGIIESPITNGYRNKCEFSVG--------LSLQGKP-TVGFSLGSFCA 373 thale cress
15232519 209 ----QVHELIRHVGRFSDNNPGLEI-----VLKPIVACDIQFHYRNKMEFSFGpqrwlpieMLNERQDGPKNFALGLHAP 279 thale cress
17561946 154 -------QLIQNKVAHLGKQTQFRDr----VLREILPAPKTAGYRNKCEFTIG--------HDLNGEI-CVGFVGGRFSK 213 Caenorhabditis elegans
20149688 117 ----YIQMLNGVSVTTAVPKSERLSc----LLHPIIPSPVINGYRNKSTFSVN--------RGPDGNPKTVGFYLGTWRD 180 human
21361612 201 ----EIGSTNRALLPWLLEQRHKHNka-ccPLEGVRPSPQQTEYRNKCEFLVG--------VGVDGEDNTVGCRLGKYKG 267 human
23270682 189 ----EIGSTNRALLPWLLEQRHKHNka-ccPLEGVRPSPQQTEYRNKCEFLVG--------VGVDGEDNTVGCRLGKYKG 255 human
1351598  145 p-----GDIVKAKLHFLADTYALAD-----FLEVISPSEDRDDTLIKCPYFAKcg----gcQYQMLSYDKQLLQKKRVVE 210 fission yeast
464650   272 NAYKFFAPrlVAEKLLP-PFDTTVASPLQFGYR---TKITPHFDMPKR-KQKELSVRpplgfgqkgrpqwrkdTLDIGGH 346 baker's yeast
25407988 374 GVTAVEEP--VDCPNVS-KIASQYASIFQKFIEn--SKFQVWNRFQHSgFWRQLTVRegrkpg----vfsndeDAITRIA 444 thale cress
15232519 280 GFFDKVLN--VDKCLLQsEPGNLVLAAVQDCWRdpeLSLSPYDCRSHVgFLKHLMLR-----------------TGRNVE 340 thale cress
17561946 214 NQHFVIPP--VDVDIVS-TQMMAIVGDVHEFVKe--SALEPFNEFDRKgFWRMLTIR-----------------EFGGDV 271 Caenorhabditis elegans
20149688 181 GNVVCVQS--NHLKNIP-EKHSQVAQYYEVFLRq--SPLEPCLVFHEGgYWRELTVR----------------TNSQGHT 239 human
21361612 268 GTCAVAAP--FDTVHIP-EATKQVVKAFQEFIRs--TPYSAYDPETYTgHWKQLTVR----------------TSRRHQA 326 human
23270682 256 GTCAVAAP--FDTVHIP-EATKQVVKAFQEFIRs--TPYSAYDPETYTgHWKQLTVR----------------TSRRHQA 314 human
1351598  211 KAFQYYSK--LDSSLLP-AIKDTVGSPLQYNYR---TKITPHFDVPKGgTKGPLIIG-----------------FQEKGR 267 fission yeast
464650   347 GSILDIDECVLATEVLnkglTNERRKFEQEFKNYKKGATIlLREntTILDPSkptleQLTEEAsrDENGDISYVEVedkk 426 baker's yeast
25407988 445 EVMLMVQVCVLNGKVA----TEFEELAKAFAEGARASSPT-LPLtvLVVQNH-----SGISNVa-PPDAPLQVLAIpisd 513 thale cress
15232519 341 TGSLELMVNFVTSSYK----PELLKPLVDRISSIPQVVS--IMN--NVNSSV-----GNTSVG----EKEYTLYGK---- 399 thale cress
17561946 272 MLIFTVFPLEDGVERM----EEIQKKIETRFLDFETFKEKkYRVcsIYWQQM-----VHISDT-----PNFKLIGG---- 333 Caenorhabditis elegans
20149688 240 MAIITFHPQKLSQEEL----HVQKEIVKEFFIRGPGAACG-LTS--LYFQES-----TMTRCS--HQQSPYQLLFG---- 301 human
21361612 327 MAIAYFHPQKLSPEEL----AELKTSLAQHFTAGPGRASG-VTC--LYFVEE-----GQRKTPs-QEGLPLEHVAG---- 389 human
23270682 315 MAIAYFHPQKLSPEEL----AELKTSLAQHFTAGPGRASG-VTC--LYFVEE-----GQRKTPs-QEGLPLEHVAG---- 377 human
1351598  268 RRVMDIEECPIATKTI----NEEYPKIIEDVQSRANTFKR-GAT---ILMRD-----SATEDG-----KHCVITDH---- 325 fission yeast
464650   427 nnvrlaktcvtnpRQIVTEYVDGYTFNFSAGEFFQNNNSILPIVTKYVRDNLQAPAKgdd-nktKFLVDAYCGSGLFSIC 505 baker's yeast
25407988 514 ngtdqeqttnvltEARIHDHINNLRFSISPTAFFQVNTVTAEKLYSIAGDWADLGPD-------TLLFDVCCGTGTIGLT 586 thale cress
15232519 400 -------------D-TITEVLRGLTFQISANSFFQTNTHQAEVLYKLIEESAGLKGDg-----sEVVLDLFCGTGTIGLT 460 thale cress
17561946 334 -------------TPYIYESLLDCRFRVSPPAFFQTNSQAAAVLYSTIGEHCGLSEK-------KTNEDVPVETDASEKA 393 Caenorhabditis elegans
20149688 302 -------------EPYIFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSD-------TILLDICCGTGVIGLS 361 human
21361612 390 -------------DRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAG-------SMVLDVCCGTGTIGLA 449 human
23270682 378 -------------DRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAG-------SMVLDVCCGTGTIGLA 437 human
1351598  326 -------------KMIVREQFGDLSFTFPAGAFFQNNNSILEKFTSYVREQLLNPFGrkehqrpKYFVDAYCGSGLFSVA 392 fission yeast
464650   506 SSKGVDKVIGVEISADSVSFAEKNAKANGVENCRFIVG-----------------------------KAEKLFESIDTP- 555 baker's yeast
25407988 587 LAHRVGMVIGIEMNASAVADAERNATINGISNCKFICSkaciltvtyfvvgsivliclhgssvgfvvQAEDVMSSLLKQy 666 thale cress
15232519 461 LARRAKHVYGYEVVPQAITDAHKNAQINGIENATFIQG------------------------------DLNKIGEDFGNn 510 thale cress
17561946 394 PEAPAAPSEPIPDDPSDAPPAKIPRIEPEPTAADEAPA------------------------------PEDPGTILLDIc 443 Caenorhabditis elegans
20149688 362 LAQHTSRVLGIELLEQAVEDARWTAAFNGITNSEFHTG-----------------------------QAEKILPGLLKSk 412 human
21361612 450 LARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCG-----------------------------RAEDLVPTLVGRl 500 human
23270682 438 LARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCG-----------------------------RAEDLVPTLVSRl 488 human
1351598  393 CSKGFLSVIGVEISADSVRYAEENAKRNNVSNATFIVG-----------------------------QAEKIFSSIETPp 443 fission yeast
464650   556 --SEN--------------------------------------------------------------------TSVILDP 565 baker's yeast
25407988 667 ldVTQmeeakplsnanddlnkqipsteemtnsehvadqnlppsntqveelqdneqkdssslepekttkpqfknVVAIVDP 746 thale cress
15232519 511 fpKPD---------------------------------------------------------------------IVISDP 521 thale cress
17561946 444 cgTGTig----------------------------------------------------------------qcLLKNIQK 459 Caenorhabditis elegans
20149688 413 edGQS--------------------------------------------------------------------IVAVVNP 424 human
21361612 501 -aSQH--------------------------------------------------------------------LVAILDP 511 human
23270682 489 -aSQH--------------------------------------------------------------------LVAILDP 499 human
1351598  444 --NET---------------------------------------------------------------------AMVIDP 452 fission yeast
464650   566 PR----KGCDELFLKQLAAYIQPRLFTYRVMSIP----RHVMSSTSSKK------------------------------- 606 baker's yeast
25407988 747 PR----SGLHPAVIKALRTHPRLKRLVYISCNPEtl-vANAIELCTPSFdepdrgnknyrgrkkigiaalarhraksmpt 821 thale cress
15232519 522 NR----PGMHMKLIKFLLKLK-SPRIIYVSCNPAtc-aRDLDYLCHGVEeknlkgc------------------------ 571 thale cress
17561946 460 SQkvccIGIEMIAEAVEDAKQNAKQNKMETCCKYi--aGKAEDTFRSMRyhlpngf------------------------ 513 Caenorhabditis elegans
20149688 425 AR----AGLHYKVIQAIRNFRAIHTLVFVSCKLHgestRNVIELCCPPDpakkllge----------------------- 477 human
21361612 512 PR----AGLHSKVILAIRRAKNLRRLLYVSCNPRaa-mGNFVD---AP-------------------------------- 551 human
23270682 500 PR----AGLHSKVILAIRRAKNLRRLLYVSCNPRaa-mGNFVDLCRAPSnrvkgip------------------------ 550 human
1351598  453 PR----KGCDQSFLNQLLEYS-PYRIVYISCNVHtq-aRDVGFLLSQEKgrsyk-------------------------- 500 fission yeast
464650   607 ---------QK--TVPPT-RLKA 617 baker's yeast
25407988 822 seafrpvkaMAvdLFPHTdHCEM 844 thale cress
15232519 572 ---yklmsvQPvdMFPHTpHIEC 591 thale cress
17561946 514 --dlrksrvVGvlDPPRAgMHEK 534 Caenorhabditis elegans
20149688 478 --pfvlqqaVPvdLFPHTpHCEL 498 human
21361612 552 -------------LFPpqplqsp 561 human
23270682 551 ---frpvkaVAvdLFPQTpHCEM 570 human
1351598  501 -----ideiRGfdLFPQShHVES 518 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap