Conserved Protein Domain Family
KOG2028

?
KOG2028: KOG2028 
KOG2028, ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]
Statistics
?
PSSM-Id: 229967
View PSSM: KOG2028
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18426902  89 AESSEGEGEEGDDGGETESRESYDAPPTPSgarliPDFPVARSSSPGRkgsgkRPAAaAAAGSASPRSW----DEAEAQE 164 human
15221721   1 MEQLVSMGFSSDLAAEALTATGGDSIQKAT------DWILSHRSSP------------QSTATLQPK------LDRFLRL 56  thale cress
18426904  89 AESSEGEGEEGDDGGETESRESYDAPPTPSgarliPDFPVARSSSPGRkgsgkRPAAaAAAGSASPRSW----DEAEAQE 164 human
19115361   1 ------MSGPDHVQCPVCAKTVTMNDINPH-----LDSHYSDSSGPS------KP---VS-----P----------FFKK 45  fission yeast
1730822    1 -MSNKRTSVEQLISCPICSRKVFFSLINSH-----LDICGKEKSKPSS-----RPQT-VSSLLAGPKKRkqanSEKFIDL 68  baker's yeast
18426902 165 EEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGAS--GGGRPHPRALAAEEIRQM--LQGKPLADTMRPDTLQDYF 240 human
15221721  57 HPKALAPAMGD---DSSKRPNP--------KTQIHVAAD--DSNKRHK--LSSSSHR-----QHQPLSERMRPRTLDDVV 116 thale cress
18426904 165 EEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGAS--GGGRPHPRALAAEEIRQM--LQGKPLADTMRPDTLQDYF 240 human
19115361  46 ERYKHHLETNVSSHQSATKFIE---------P---------EPSPTKKTKLTRRDTR--------PLAERARPKSLDEYV 99  fission yeast
1730822   69 ENKDHEIKPGLKSESDDIEIVENESKRFKAAPSTDFAKSivEPASSRDQLHNDYESRWLqkISHLPLSEKLRPKELRDYV 148 baker's yeast
18426902 241 GQSKAVGQ-DTLLRSLLETNEIPSLILWGPPGCGKTTLAHIIASNSKKHS--------IRFVTLSATNAKTNDVRDVIKQ 311 human
15221721 117 GQDHLLSP-SSLLRSAVESNRLPSIVFWGPPGTGKTSIAKSLINSSKDPSl-------YRFVSLSAVTSGVKDVRDAVES 188 thale cress
18426904 241 GQSKAVGQ-DTLLRSLLETNEIPSLILWGPPGCGKTTLAHIIASNSKKHS--------IRFVTLSATNAKTNDVRDVIKQ 311 human
19115361 100 GQEELVGE-RGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSR-----------FIEISATSTTVADCRKIFED 167 fission yeast
1730822  149 GQQHILSQdNGTLFKYIKQGTIPSMILWGPPGVGKTSLARLLTKTATTSSnesnvgsrYFMIETSATKANTQELRGIFEK 228 baker's yeast
18426902 312 AQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMR 391 human
15221721 189 AKRLNLEGRKRTVLFMDEVHRFNKSQQDTFLPVIEDGSILFIGATTENPSFHLITPLLSRCRVLTLNPLKPNHVETLLRR 268 thale cress
18426904 312 AQNEKSFFKRKTILFIDEIHRFNKSQQ-------------------------VNAALLSRCRVIVLEKLPVEAMVTILMR 366 human
19115361 168 SQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNH 247 fission yeast
1730822  229 SKKEYQLTKRRTVLFIDEIHRFNKVQQDLLLPHVENGDIILIGATTENPSFQLNNALISRCLIFVLEKLNVNELCIVLSR 308 baker's yeast
18426902 392 AINSLGihvlDSSRPTDPLSHSSnsssepaMFIEDKAVDTLAYLSDGDARAGLNGLQLAvlarLSsrkMFCKKSGQSysp 471 human
15221721 269 AVD-------DSER---GLPN-S-------VEVDDSVIEFLANNCDGDARVALNALEIS----AT---MATTRAG----- 318 thale cress
18426904 367 AINSLGihvlDSSRPTDPLSHSSnsssepaMFIEDKAVDTLAYLSDGDARAGLNGLQLAvlarLSsrkMFCKKSGQSysp 446 human
19115361 248 --ACLL----ESERLGSSMPN-----------VETSIIDYISAITDGDARMALNALEMS---------IGMLRQG----- 296 fission yeast
1730822  309 GIALLN----KCRKQVWNIENPL--------KLSRSILEYVVDLSVGDTRRALNMLEMI---------EVSTRERKA--- 364 baker's yeast
18426902 472 SRVLITENDVKEGLQRSH-----ILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASED 546 human
15221721 319 TDAVVSIDDAKEALQCKH-----LAYDKAGEQHYNLISALHKSMRGGDANAAIYWLARMLEGGEEPLYIARRLIRFASED 393 thale cress
18426904 447 SRVLITENDVKEGLQRSH-----ILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASED 521 human
19115361 297 ---PLSLEDIKDKLVRSS-----ALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASED 368 fission yeast
1730822  365 DEEELSIDDVRDIIKNNSsnglnTYYDPKGDNHYDTISAFHKSIRGGDENASLYYLARMLQGGEDPLYVARRMIRIASED 444 baker's yeast
18426902 547 IGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRN--HQGPLPPVPLHLRNAPTR 624 human
15221721 394 IGLADPSALTQAVACYQASHFLGMPECNVILAQCTAYLALAPKSIAVYRAIGAAQKVVKD--SVGQNEGVPLHLRNAPTK 471 thale cress
18426904 522 IGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRN--HQGPLPPVPLHLRNAPTR 599 human
19115361 369 IGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSh-PDAGRAEIPMHIRNAPTN 447 fission yeast
1730822  445 IGLRDSSLLPLAVAAHDAVMKVGLPEADLALAQCCVALARAPKSVELYRAWKKLRAMMSEnmYSLASSEIPMHIRNAPTK 524 baker's yeast
18426902 625 LMKDLGYGKGYKYNPMY-SEPVDQEYLPEELR-----------GVDFFKQ-RRC 665 human
15221721 472 LMKELGYGKEYIYPPSDpSSAAGQTYLPPSLLhhkflewpegaSGDFQDQeHRL 525 thale cress
18426904 600 LMKDLGYGKGYKYNPMY-SEPVDQEYLPEELR-----------GVDFFKQ-RRC 640 human
19115361 448 LMKQLGYHKGYKYNPDYkDGLVMQEVIKNILFnllt----ysvFTRFYQGnKVL 497 fission yeast
1730822  525 LMEELGYHKGYKYNPDYiEGKVQQDYFPKEVLekcp----nktDLKFLDGkHLG 574 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap