2IF1


Conserved Protein Domain Family
KOG1770

?
KOG1770: KOG1770 
Click on image for an interactive view with Cn3D
KOG1770, Translation initiation factor 1 (eIF-1/SUI1) [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 229709
View PSSM: KOG1770
Aligned: 12 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IF1      14 MSAIQNLHSFDPFADASKGd--DLLPAGTED-YIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHP 90  human
11135384   1 -MSIQNLNTRDPFADAIKGn-dDDIQDG----LVHIRIQQRNGRKTLTTVQGLSAEYDLKKIVRSCKKEFACNGTVIEHP 74  fruit fly
21264042   3 DLEVQVPTAFDPFADANAE----DSGAGTKE-YVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDLKKEFCCNGTVVQDS 77  thale cress
2507421    3 ELDSQVPTAFDPFADANAE----DSGAGTKE-YVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDS 77  thale cress
2507421    3 ELDSQVPTAFDPFADANAE----DSGAGTKE-YVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDS 77  thale cress
18423691   3 ELDIQIPSAYDPFAEAKDS----D-APGAKE-NIHIRIQQRNGKKSLTTVQGLKKEYSYERILKDLKKDFCCNGNVVQDK 76  thale cress
13775494   1 ----MSIANLNRPADAFEQ---LETEDGVRQgVCHIRIQQRTGRKTITTVQGIGTEYDLKRIVQYLKKKHSCNGTIVEHP 73  Caenorhabditis elegans
13775494   1 -------msianlnrpadafeqletedgvrqgvchiriqqrtgrktittvqgigteydlkrivqylkKKHSCNGTIVEHP 73  Caenorhabditis elegans
19074965  11 EHINAKEEDLSTSENPRAGqygERDIIQEEKsVIRVKVQQKKGTKKVTIIENIPMELR-ESLLSSLKREMGCGGILLDDK 89  Encephalitozoon cun...
12644074   1 MSTIQNLQSFDPFADATKGd--DLLPAGTED-YIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHP 77  human
18545489   1 MSAIQNFNTVDPFADTGDD----D--AQPLN-NIHIRIQQRNGRKTLTTVQGLPREFDQKRILRALKKDFACNGTIVKDD 73  fission yeast
417828     1 -MSIENLKSFDPFADTGDD----E--TATSN-YIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDP 72  baker's yeast
2IF1      91 EYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF 126 human
11135384  75 EYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF 110 fruit fly
21264042  78 ELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 thale cress
2507421   78 ELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 thale cress
2507421   78 ELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 thale cress
18423691  77 ELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112 thale cress
13775494  74 EYGEVIQLTGDQRDKVKDFLIKVGIVNESNCRVHGF 109 Caenorhabditis elegans
13775494  74 EYGEVIQLTGDQRDKVKDFLIKVGIVNESNCRVHGF 109 Caenorhabditis elegans
19074965  90 ---SSIQLQGD-KTNMGIVTYLKKYIKDCRVELNGR 121 Encephalitozoon cuniculi
12644074  78 EYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF 113 human
18545489  74 DLGEVIQLQGDQRIKVMEFLTQQLGLQKKNIKIHGF 109 fission yeast
417828    73 EMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF 108 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap