Conserved Protein Domain Family
KOG1673

?
KOG1673: KOG1673 
KOG1673, Ras GTPases [General function prediction only]
Statistics
?
PSSM-Id: 229614
View PSSM: KOG1673
Aligned: 4 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30686351  83 FVRRSSVVYDNDNSHrrsdSDLVSLKISLLGDPEIGKTSFLAKYVGEEKEvEMRELEKGINCTDKTLYMGGARISYSIWE 162
gi 15239761  80 TTTEPTVSGRRFGSSs--dSDLVSLKISLLGDCQTGKTTFVVKYVGDEN--QSFLEMTGLNLMDKTFYVQGVTISFSIWD 155
gi 21542235   1 ----------MADAR----KNNVTIKVGMIGDSSIGKTSLMVTYVQGSFD-EESTQTLGVNFMEKTISIRNTEITFSIWD 65
gi 730928     1 MATPSTGANNSIPAV----RNQVEVQVGLVGDAQVGKTSLMVKYVQNIYD-KEYTQTLGVNFLKRKVSIRSTDIIFSIMD 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30686351 163 LEGAE-RSRDQIPVACKDSVAILFMFDLTSRCTLNSVISWYQQARKSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQART 241
gi 15239761 156 VGGDEkRSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDFVRLPPNLQWTIVTQARA 235
gi 21542235  66 LGGQR-EFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGFNKTAVPILIGTKYDHFMTFPREDQEEITKQARR 144
gi 730928    76 LGGQR-EFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMK 154
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|.
gi 30686351 242 YAKALNATLFFSSASYNINVNKIFKFVTAKLFDLPWTVERNLTIGEPIIDF 292
gi 15239761 236 YAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGEPIIDY 286
gi 21542235 145 YAKAMKASLVFCSTSHSINVQKIFKIVLAKVFDLKCTIPEIKNVGDPILEY 195
gi 730928   155 YAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIY 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap