Conserved Protein Domain Family
KOG1562

?
KOG1562: KOG1562 
KOG1562, Spermidine synthase [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 229503
View PSSM: KOG1562
Aligned: 12 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1082797    4 AAARHSTLDFMLG--AKADGETi------LKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGsfanlrIYPHGLVLLDL 75  human
7294595    1 MAAQTILFDFTLDkdKTADEEArlqvakiLRNELEQLFPQLELAYSMESPENGYFAVLHENKDtvitcrIFQHGLLTLNV 80  fruit fly
7294596    1 MAAQTILFDFTLDkdKTADEEArlqvakiLRNELEQLFPQLELAYSMESPENGYFAVLHENKDtvitcrIFQHGLLTLNV 80  fruit fly
7299220    1 ----------------------------------------------MDSLNNGWFSELQAD--------LWPGQSFSLKV 26  fruit fly
12230014   4 KETSATDL--KRPr--EEDDNGga-----atMETENGD-QKKEPACFSTVIPGWFSEMSPMWP---------GEAHSLKV 64  thale cress
12644069   5 QEASVTDLPVKRPreAEEDNNGg-------aMETENGGGEIKEPSCMSSIIPGWFSEISPMWP---------GEAHSLKV 68  thale cress
9757993    2 EGDVGIGLVCQNTmdGKASNGNglektvpSCCLKAMACVPEDDAKCHSTVVSGWFSEPHPRS----------GEAHSLKV 71  thale cress
8247960    2 AAARHSTLDFMLG--AKADGETi------LKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGsfanlrIYPHGLVLLDL 73  human
4507209    1 ---------------MEPGPDGpaa-------------------sgPAAIREGWFRETCSL---------WPGQALSLQV 37  human
1174417    1 ---------------------------------------MSVQELSHPLIKDGWFREINN---------MWPGQAMTLKV 32  fission yeast
6094342    1 ----------------------------------------MVNNSQHPYIKDGWFREINDKS--------FPGQAFTMTV 32  baker's yeast
2498945    1 ----------------------------------------MAQEITHPTIVDGWFREISDT--------MWPGQAMTLKV 32  baker's yeast
1082797   76 QSYDGDaqgkEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKIL 155 human
7294595   81 EYFLPDg--kEPSISFDSGKSLENVLAIKLKAIKAQKLPTLKRG-DVSRYFPSSDERIIEYDIDKVVFEARSPFQKIQIM 157 fruit fly
7294596   81 EYFLPDg--kEPSISFDTMRTMELILRQKFDSDRSKYLPPIKRGGYIDIYMTSSDERIIEYDIDKVVFEARSPFQKIQIM 158 fruit fly
7299220   27 KEVIHK----EKSRFQDIQIVETETYGRCLILDGIIQCTARDEFSYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREVVK 102 fruit fly
12230014  65 EKVLFQ----GKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVAR 140 thale cress
12644069  69 EKILFQ----GKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVAR 144 thale cress
9757993   72 EKVLFK----DKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISR 147 thale cress
8247960   74 QSYDGDaqgkEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKIL 153 human
4507209   38 EQLLHH----RRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVK 113 human
1174417   33 KKVLYA----GKSKYQDVLVFESETYGHVLVLDGAIQATERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVK 108 fission yeast
6094342   33 DSILYE----ARSEFQDILIFRNKVYGTVLVLDGIVQCTEFDEFAYQEMITHIAMFAHSNPKRVLIIGGGDGGVLREVAK 108 baker's yeast
2498945   33 EKVLHH----EKSKYQDVLIFKSTTYGNVLVLDNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVK 108 baker's yeast
1082797  156 HsKQFGNILILSGDVNLAESDLAYTRAIMGSgkedYTGKDVLILGGgDGGILCEIVK----LKPKMVTMVEIDQMVIDGC 231 human
7294595  158 HsKTLGNMLLLDELQNIAESDLIYTETLMCRgvenYEGKEICILGGgDGALLYELLK----ENPKHVVMLEIDELVMQTC 233 fruit fly
7294596  159 HsKTLGNMLLLDELQNIAESDLIYTETLMCRgvenYEGKEICILGGgDGALLYELLK----ENPKHVVMLEIDELVMQTC 234 fruit fly
7299220  103 H-PLVEEVHQVEIDDRVVELSKQYLPAMACG----FANEKLKLTIG-DGFDYMKKH-----KNEFDVIITDSSDPIGPAV 171 fruit fly
12230014 141 H-ASIEQIDMCEIDKMVVDVSKQFFPDVAIG----YEDPRVNLVIG-DGVAFLKNAA----EGSYDAVIVDSSDPIGPAK 210 thale cress
12644069 145 H-SSVEQIDICEIDKMVVDVAKQYFPNVAVG----YEDPRVNLIIG-DGVAFLKNAA----EGTYDAVIVDSSDPIGPAK 214 thale cress
9757993  148 H-SSVEVIDICEIDKMVIDVSKKFFPELAVG----FDDPRVQLHIG-DAAEFLRKSP----EGKYDAIIVDSSDPVGPAL 217 thale cress
8247960  154 HsKQFGNILILSGDVNLAESDLAYTRAIMGSgkedYTGKDVLILGGgDGGILCEIVK----LKPKMVTMVEIDQMVIDGC 229 human
4507209  114 H-PSVESVVQCEIDEDVIQVSKKFLPGMAIG----YSSSKVTLHVG-DGFEFMKQN-----QDAFDVIITDSSDPMGPAE 182 human
1174417  109 H-ECVEEAILCDIDEDVIKVSKQYLPEMSAG----FNHPKVKVHIG-DGFKFLQDY-----QNTFDVIITDSSDPDGPAE 177 fission yeast
6094342  109 H-SCVEDITMVEIDSSVIELSRKFLPTLSNGa---FDDERLDLKLC-DGFKFLQDIGasdvHKKFDVIITDSSDPEGPAE 183 baker's yeast
2498945  109 H-DSVEEAWLCDIDEAVIRLSKEYLPEMAAS----YSHPKVKTHIG-DGFQFLRDY-----QNTFDVIITDSSDPEGPAE 177 baker's yeast
1082797  232 KKYMRKTCGDVLDNLKGDCYQVLIE-DCIPVLKRYAKEGREFDYVIND-LTAVPISTSPeedsTWEFLRLILDLSMKvLK 309 human
7294595  234 NKYLNVICGDVLEKRKGDQYEIIVG-DCVEYLKKFIAEGRKFDYVFGD-LTDIPITDAPeg-eTWDFIRTIFEHSFKvLK 310 fruit fly
7294596  235 NKYLNVICGDVLEKRKGDQYEIIVG-DCVEYLKKFIAEGRKFDYVFGD-LTDIPITDAPeg-eTWDFIRTIFEHSFKvLK 311 fruit fly
7299220  172 SLFQESYYELMKHALKDDGIVCSQG-GSFWLDLDYIKKTMSGCKEHFA-KVAYAVTSVP----SYPCGHIGFVMGS--LN 243 fruit fly
12230014 211 ELFEKPFFQSVARALRPGGVVCTQA-ESLWLHMDIIEDIVSNCREIFKgSVNYAWTSVP----TYPSGVIGFMLCST-EG 284 thale cress
12644069 215 ELFEKPFFESVNRALRPGGVVCTQA-ESLWLHMDIIEDIVSNCRDIFKgSVNYAWTSVP----TYPSGVIGFMLCSS-EG 288 thale cress
9757993  218 ALVEKPFFETLARALKPGGVLCNMA-ESMWLHTHLIEDMISICRQTFK-SVHYAWSSVP----TYPSGVIGFVLCST-EG 290 thale cress
8247960  230 KKYMRKTCGDVLDNLKGDCYQVLIE-DCIPVLKRYAKEGREFDYVIND-LTAVPISTSPeedsTWEFLRLILDLSMKvLK 307 human
4507209  183 SLFKESYYQLMKTALKEDGVLCCQG-ECEWLHLDLIKEMRQFCQSLFP-VVAYAYCTIP----TYPSGQIGFMLCS--KN 254 human
1174417  178 ALFQKPYFQLLSDALRGGGVITTQA-ECMWIHLGVISNVLTAVKTVFP-NVRYAYTTIP----TYPSGSIGFVVAS--KD 249 fission yeast
6094342  184 AFFQERYFELLKDALNPNGVVIMQSsENFWLNLKYLHDLKNTAKKVFP-NTEYCYTMVP----TYTSGQLGLIVCS--NN 256 baker's yeast
2498945  178 TLFQKEYFQLLNSALTEKGVITTQA-ESMWIHLPIIKDLKKACSEVFP-VAEYSFVTIP----TYPTGTIGFMVCS--KD 249 baker's yeast
1082797  310 QDGKYFTQGNCVNLTEALSLYEEQLgrLYCPVEFSKEIVCVPSYLELWVFYTVWK 364 human
7294595  311 PDGKYLTHGNGSTCKVQLRLFEEQLnlLRPKVKFTTTKAFVPSFMEEWLFYQVTF 365 fruit fly
7294596  312 PDGKYLTHGNGSTCKVQLRLFEEQLnlLRPKVKFTTTKAFVPSFMEEWLFYQVTF 366 fruit fly
7299220  244 KNQDFATPK--LGKSEIDSID---L--RYYSSEVHSAAFALPRWVQKHFYE---- 287 fruit fly
12230014 285 PDVDFKHPLNPID--ESSSKSNGPL--KFYNAEIHSAAFCLPSFAKKVIESKAN- 334 thale cress
12644069 289 PQVDFKKPVSLIDTDESSIKSHCPL--KYYNAEIHSAAFCLPSFAKKVIDSKAN- 340 thale cress
9757993  291 PAVDFKNPINPIEKLDGAMTHKREL--KFYNSDMHRAAFALPTFLRREVASLLAS 343 thale cress
8247960  308 QDGKYFTQGNCVNLTEALSLYEEQLgrLYCPVEFSKEIVCVPSYLELWVFYTVWK 362 human
4507209  255 PSTNFQEPVQPLTQQQVAQMQ---L--KYYNSDVHRAAFVLPEFARKALNDVS-- 302 human
1174417  250 ASIDLSKPLRKWSPEEENKLC------KYYNSEIHAASFVLPTFARDVVDKATSS 298 fission yeast
6094342  257 ANIPLNIPQRKISEQEQGKLK-------YYNPQIHSSAFVLPTWADKVINE---- 300 baker's yeast
2498945  250 KTCNVKKPLREISDEKEAELY------RYYNKKIHEASFVLPTWAAKELN----- 293 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap