Conserved Protein Domain Family
KOG1537

?
KOG1537: KOG1537 
KOG1537, Homoserine kinase [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 229478
View PSSM: KOG1537
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227800   7 QSPSKPISYFQPKSNPSPPLFAKVSVFRCRASVQTLVAVEPEPVFVSVKTFAPATVANLGPGFDFLGCAVDGLgdHVTLR 86  thale cress
14194895   1 -MQKFQIKVPASSANIGPGFDVLGMSLEEYMTLDVEVS------TESGP--CVLTY--EGDGKEHVSLDVQKN--MITQT 67  fission yeast
125396     1 MVRAFKIKVPASSANIGPGYDVLGVGLSLFLELDVTIDSSQAQETNDDPNNCKLSYTKESEGYSTVPLRSDAN--LITRT 78  baker's yeast
15227800  87 VDPSVRAGEVSISEITgtTTKLSTNPLRNCAGIAAIATMKMLGIRSVGLSLDLhkGLPLGSGLGSSAASAAAAAVAVNEI 166 thale cress
14194895  68 SLYVLRCNNISTFPYA--TKIHVINPIPLGRGMGSSGSAAIAGVMLANEIAKL--GLSKLQMMDYVLMIERHPDNVMASM 143 fission yeast
125396    79 ALYVLRCNNIRNFPSG--TKVHVSNPIPLGRGLGSSGAAVVAGVILGNEVAQL--GFSKQRMLDYCLMIERHPDNITAAM 154 baker's yeast
15227800 167 FGRKLGSdqLVLAGLESEAKVSGYHADNIAPAIMGG--FVLIRNYEPLDL-KPLRFPSDKDLFFVLVSPDFEAPTKKMRA 243 thale cress
14194895 144 MGGFVGS--FLRELSEEEKNAFSPSADDLLKN--------EALTLPPKSLgTFARLPWASELKAIVVIPEFHLATSKARS 213 fission yeast
125396   155 MGGFCGS--FLRDLTPQEVERREIPLAEVLPEPSGGedTGLVPPLPPTDIgRHVKYQWNPAIKCIAIIPQFELSTADSRG 232 baker's yeast
15227800 244 ALPTEIPMVHHVWNSSQAAALVAAVLEG-DAVMLGKALSSDKIVEPTRAPLIPGMEAVKKAALEA---GAFGCTISGAGP 319 thale cress
14194895 214 VLPTSYGRTDVVYNLQRLALLTTALGQTpINPHLVYEVMKDKVHQPYRASLIPGLQNILATLNPDtqpGLCGICLSGAGP 293 fission yeast
125396   233 VLPKAYPTQDLVFNLQRLAVLTTALTMDpPNADLIYPAMQDRVHQPYRKTLIPGLTEILSCVTPStypGLLGICLSGAGP 312 baker's yeast
15227800 320 TAVAVIDseEKGQVIGEKMVEAFWKVGHLKSVASVK-KLDNVGARLV 365 thale cress
14194895 294 TVLALAT--GNFDEIAHAMLSIFEKHGVKCRYLVLSpAFDGATVKYF 338 fission yeast
125396   313 TILALAT--ENFEEISQEIINRFAKNGIKCSWKLLEpAYDGASVEQQ 357 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap