Conserved Protein Domain Family
KOG1511

?
KOG1511: KOG1511 
KOG1511, Mevalonate kinase MVK/ERG12 [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229452
View PSSM: KOG1511
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17555862  36 TSQHggLFVSAPGKIILFGEHAVVYGRTAIAGSID-LRTYVSL---YTSA--DGRIYLSLPDLGVEKTWMLKDLLKAADR 109 Caenorhabditis elegans
7303424    1 MLKF---QVHSPGKVILHGEHAVVYHRPALAAVVG-LGTTLRFr--QLED--SQVASFQLEALNCTLEIQLPEFNGFLAE 72  fruit fly
1170660    1 -MEV---KARAPGKIILAGEHAVVHGSTAVAAAID-LYTYVTLrfpLPSAenNDRLTLQLKDISLEFSWSLARIKEAIPY 75  thale cress
19173299   1 -MVY---LARSPLKVILFGEHGVLSGGRCLAVAID-----------VYGY------LA-MKSSSINKAIIIDT------- 51  Encephalitozoon cun...
417215     2 LSEV--LLVSAPGKVILHGEHAVVHGKVALAVSLN-LRTFLRL---QPHS--NGKVDLSLPNIGIKRAWDVAR-LQSLDT 72  human
1170661    1 MSKS--LIVSSPGKTILFGEHAVVYGATALAAAVS-LRSYCKL---QTTN--NNEIVIVMSDIGTERRWNLQS----LPW 68  fission yeast
125407     1 MSLP--FLTSAPGKVIIFGEHSAVYNKPAVAASVSaLRTYLLIs--ESSA--PDTIELDFPDISFNHKWSINDFNAITED 74  baker's yeast
17555862 110 LAAEYpiEEDQPPSLEILVPIARKLSGSCEDQCGV-QHLAILAFWYLLLGVAHRKSGlsrlarGLPApplpeglhrtnLS 188 Caenorhabditis elegans
7303424   73 FRSKYpsDSTANLLEAVRAEVSKQLERSGGNAPKQhTQRAFISIYYLLAGAVLSAPGdk--klTLQTg----------FQ 140 fruit fly
1170660   76 DSSTL---CRSTPASCS-EETLKSIAVLVEEQNLPkEKMWLSSGISTFLWLYTRIIG------FNPA------------T 133 thale cress
19173299  52 ------------------------NGNCVDLIEKYkYAIPGFDAI----------------------------------- 72  Encephalitozoon cun...
417215    73 SFLEQ--GDVTTPTSEQ-VEKLKEVAG-LPDDCAVtERLAVLAFLYLYLSICRKQr-------ALPS-----------LD 130 human
1170661   69 QHVTV--ENVQHPASSPNLDLLQGLGELLKNEENGlIHSAMLCTLYLFTSLSSPSQG---------------------CT 125 fission yeast
125407    75 QVNSQklAKAQQATDGLSQELVSLLDPLLAQLSESfHYHAAFCFLYMFVCLCPHAKN---------------------IK 133 baker's yeast
17555862 189 VIgatsaqpekseaeialslpvppltplpspgAQSTAPpvfptstptptstptpllPGnlradspavqqdllavkatvrf 268 Caenorhabditis elegans
7303424  141 VQ------------------------------VDSQLT------------------VG---------------------- 150 fruit fly
1170660  134 VV------------------------------INSELP------------------YG---------------------- 143 thale cress
19173299  73 LF--------------------------------LETP------------------LG---------------------- 80  Encephalitozoon cun...
417215   131 IV------------------------------VWSELP------------------PG---------------------- 140 human
1170661  126 LT------------------------------ISSQVP------------------LG---------------------- 135 fission yeast
125407   134 FS------------------------------LKSTLP------------------IG---------------------- 143 baker's yeast
17555862 269 klpscVGLGSSGAYCVCIATSLLQTAGLIPPPsivadEqGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGV 348 Caenorhabditis elegans
7303424  151 -----AGLGSSASFGAALATTFLILAGHFDRD-------SYLSEANQ--ALISSWAYESERVNHGTPSGLDNTVCTYGGM 216 fruit fly
1170660  144 -----SGLGSSAALCVALTAALL--ASSISEKt---rGnGWSSLDETNLELLNKWAFEGEKIIHGKPSGIDNTVSAYGNM 213 thale cress
19173299  81 -----CGLGTSAAISLLMSYGKAR----G--P--------------N--MLREAYAMEN--TFHGKSSGVDVSTCYSGGL 131 Encephalitozoon cun...
417215   141 -----AGLGSSAAYSVCLAAALLTVCEEIPNPlk--dGdCVNRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGA 213 human
1170661  136 -----AGLGSSATISVVVATSLLLAFGNIEPP-----S-SNSLQNNKALALIEAWSFLGECCIHGTPSGIDNAVATNGGL 204 fission yeast
125407   144 -----AGLGSSASISVSLALAMAYLGGLIGSN-------DLEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNA 211 baker's yeast
17555862 349 ASFKPGH--------RIEHLKNLPDLRVILVNSKVERNTARMVQTVKERL-KKFPEVVDAMFGSIDAISLDAAKILHRpl 419 Caenorhabditis elegans
7303424  217 LRYVKGQ--------GFQSLKIQKPLNILLVDSRVSRSTADIVAKVRHLG-DAFPQLIEAIWQACEELVAAAVPLYESf- 286 fruit fly
1170660  214 IKFCSG---------EITRLQSNMPLRMLITNTRVGRNTKALVSGVSQRA-VRHPDAMKSVFNAVDSISKELAAIIQ--- 280 thale cress
19173299 132 ISFKEGv-------vEKLSVDHLSQFKILIFNSQISKNTEAAVRLGELNR---------ELYDEIGKVSEEAYWLLQR-- 193 Encephalitozoon cun...
417215   214 LRYHQG---------KISSLKRSPALQILLTNTKVPRNTRALVAGVRNRL-LKFPEIVAPLLTSIDAISLECERVLG--- 280 human
1170661  205 IAFRKATahq---saMKEFLKPKDTLSVMITDTKQPKSTKKLVQGVFELK-ERLPTVIDSIIDAIDGISKSAVLALTS-- 278 fission yeast
125407   212 LLFEKDShngtintnNFKFLDDFPAIPMILTYTRIPRSTKDLVARVRVLVtEKFPEVMKPILDAMGECALQGLEIMTKls 291 baker's yeast
17555862 420 leengggdtgstvqENGLGPFGGnmvEQdhhslqptrtasvrssslssyvgggkrnssasvisatsekgenvdtfsKLND 499 Caenorhabditis elegans
7303424  287 --------------GNAQDDSSKf--EQ-------------------------------------------------LER 301 fruit fly
1170660  281 --------------SKDETSVTEk--EE------------------------------------------------RIKE 296 thale cress
19173299 194 -----------------EFTLP------------------------------------------------------ELYK 202 Encephalitozoon cun...
417215   281 --------------EMGEAPAP----EQy----------------------------------------------lVLEE 296 human
1170661  279 --------------ESDKNSSAK-----------------------------------------------------KLGE 291 fission yeast
125407   292 kc---------kgtDDEAVETNNelyEQ-------------------------------------------------LLE 313 baker's yeast
17555862 500 LCRINNQLLIALGVGHPKVDLICTTLARYGIHP-KMTGAGGGGSVFAFLKPNTPQ-TLLDMIDGELRSH-GFEVWQPPLG 576 Caenorhabditis elegans
7303424  302 LFQINNDLLKAIGVSHPKLEQIFTIAFKRGFFS-KLTGAGAGGYVIVLLPENYECnEVYWKLKEELESA-GFGVHVTTAG 379 fruit fly
1170660  297 LMEMNQGLLLSMGVSHSSIEAVILTTVKHKLVS-KLTGAGGGGCVLTLLPTGT----VVDKVVEELESS-GFQCFTALIG 370 thale cress
19173299 203 LIRKSQDLLDRLGVCPDEMRKVVSKMRKLGIEA-KITGAGCGGHLVTVVKKGQ----QIPGWRSVSIDHqGFHVFGTEL- 276 Encephalitozoon cun...
417215   297 LIDMNQHHLNALGVGHASLDQLCQVTRARGLHS-KLTGAGGGGCGITLLKPGLEQ-PEVEATKQALTSC-GFDCLETSIG 373 human
1170661  292 FIVLNQKLLECLGVSHYSIDRVLQATKSIGWT--KLTGAGGGGCTITLLTPECKE-EEFKLCKESLLAH-KNSIYDVQLG 367 fission yeast
125407   314 LIRINHGLLVSIGVSHPGLELIKNLSDDLRIGStKLTGAGGGGCSLTLLRRDITQ-EQIDSFKKKLQDDfSYETFETDLG 392 baker's yeast
17555862 577 GPGVVEHQTRPe------------LFQTPVSSTQCS----T 601 Caenorhabditis elegans
7303424  380 GEGLRVSSLDD------------------------------ 390 fruit fly
1170660  371 GNGAQICY--------------------------------- 378 thale cress
19173299     ----------------------------------------- Encephalitozoon cuniculi
417215   374 APGVSIHSAT--------------SLDSRVQQALDG----L 396 human
1170661  368 GPGVSVVTDSDsf---------fpQYESDFDFKKLN----L 395 fission yeast
125407   393 GTGCCLLSAKNlnkdlkikslvfqLFENKTTTKQQIddllL 433 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap