Conserved Protein Domain Family
KOG1500

?
KOG1500: KOG1500 
KOG1500, Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones, Transcription]
Statistics
?
PSSM-Id: 229441
View PSSM: KOG1500
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084   1 MAAAAAAVGPGAGGAGSAVPggagpcATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIALYSHEDVC-- 78
gi 7299276    1 MSSLRPEEARKLATAASVSP------LSNCQFCGVVISSIADEQKLEFTNKYKGSCTLLCSYDSQGVVLRVVSDDDRShv 74
gi 6729000      --------------------------------------------------------------------------------
gi 10177192   1 MEIPSLNKQQEFTLASVTDLtspsssLSSSPVVATFSCVNEVKELRFQESKSSDGFSFDLSSTQLFKLGPLQFTCVSDgs 80
gi 18571812     --------------------------------------------------------------------------------
gi 22046917     --------------------------------------------------------------------------------
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084  79 VFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRgHTLERSVFSERTEESSAVQYFQFYGYLSQ 158
gi 7299276   75 LKEYMIAADTDAAQMGRRSYAVSLDADNLVLRFASEQDQQLFRKVVENVK-HLRPKSVFSQRTEESSASQYFQFYGYLSQ 153
gi 6729000    1 ---------------------------------------------------------------------MYFHYYGQLLH 11
gi 10177192  81 ISSAKEKSSFSRGVVIKFRDEKDSKEFCDSFEECKKDDAVKQGSALPNGTvVSANKSKFDDKIEAASAKMYFHYYGQLLH 160
gi 18571812     --------------------------------------------------------------------------------
gi 22046917     --------------------------------------------------------------------------------
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084 159 QQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSN-NLTDRIVV 237
gi 7299276  154 QQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMAQYAQQLVESN-NVQHKISV 232
gi 6729000   12 QQNMLQDYVRTGTYYAAVMENHSDFAGRVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYARKLIAGNpLFADRITV 91
gi 10177192 161 QQNMLQDYVRTGTYHAAVMENRSDFSGRVVVDVGAGSGILSMFAALAGAKHVYAVEASEMAEYARKLIAGNpLLAERITV 240
gi 18571812   1 -----------------------------------------------------------------MLVKNN-HLSDKIIV 14
gi 22046917     --------------------------------------------------------------------------------
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084 238 IPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQP 316
gi 7299276  233 IPGKIEEIELPEKVDVIISEPMGYMLYNERMLETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQS 311
gi 6729000   92 IKGKVEDIELPEKADILISEPMGTLLVNERMLESYVIARdRFMTPKGKMFPTVGRIHMAPFSDEFLFIEMANKAMFWQQQ 171
gi 10177192 241 IKGKIEDIELPEKADVLISEPMGTLLVNERMLETYVIARdRFLSPNGKMFPTVGRIHMAPFADEFLFVEMANKALFWQQQ 320
gi 18571812  15 LPGKTEDVSLPEAVDVIISEPMGYMLFNERMLESYLHSK-KWLKSNGMMFPTFSDIHLAPFSDEQLYVEHFSRANFW--- 90
gi 22046917   1 -----------------------------------------------MMFPTFSDIHLAPFSDEQLYVEHFSRANFWYQQ 33
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084 317 SFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEA---------------------------------- 362
gi 7299276  312 AFHGVDLTTLHKEGMKEYFRQPIVDTFDIRICMAKSVRHVCDFLND---------------------------------- 357
gi 6729000  172 NYYGVDLTPLYGSAHQGYFSQPVVDAFDPRLLVASPMFHMIDFTQM---------------------------------- 217
gi 10177192 321 NYYGVDLTPLYVSAHQGYFSQPVVDAFDPRLLVAPSMFHVIDFTMMtvklfptldsvprcflkiedtflscyfyvqsslf 400
gi 18571812     --------------------------------------------------------------------------------
gi 22046917  34 CFYGVNLSSLQGATVDEYFRQPIVDTFDVRILMAGTVKYTANFMDA---------------------------------- 79
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084 363 ---------------KEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLF 427
gi 7299276  358 ---------------KEDDLHLISIPLEFHILQTGICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIF 422
gi 6729000  218 ---------------KEEDFYEIDIPLKFTASMCTRMHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQIRCVLSQPIY 282
gi 10177192 401 sewhdpnsitvkffsQEEQFYEIDIPLKFTASVCTRIHGLACWFDVLFDGSTVQRWFTTAPGAPTTHWYQIRCVLSQPIH 480
gi 18571812     --------------------------------------------------------------------------------
gi 22046917  80 ---------------EEEDLHRWQS---------GLIHGLAFWFDVAFVGSLYVYPPPTFSQSALPHAIYYL-------- 127
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18601084 428 AKAGDTLSGTCLLIANKRQSYDISIVAQVDQT---------GSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWN 498
gi 7299276  423 IKQGQTLTGRVLLEANRRQSYDVTIDLHIEGT---------LISSSNTLDLKNPYFRYTGAPVQAPPGTSTQSPSEQYWT 493
gi 6729000  283 VMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWgpgasqggiLQSSTCKFDLKEPYYRMSQPQAYPVAQEPPLQPQPELST 362
gi 10177192 481 VMAGQEITGRLHLIAHSAQSYTINLTLSAKMWgpganqggiLQTSSCKLDLKEPYYRMSQPQVYP-TQEPPAQ------S 553
gi 18571812     --------------------------------------------------------------------------------
gi 22046917     --------------------------------------------------------------------------------
                       570       580
                ....*....|....*....|....*.
gi 18601084 499 TGSTYNLSSGMAVAGMPTAYDLSSVI 524
gi 7299276  494 QVDTQGSRNSSSMLNGGISVNG---I 516
gi 6729000  363 QDIQTPNDELEEELLQQLPQNPSAQL 388
gi 10177192 554 QDIHIHSDDLEE--LELLQQNANAQL 577
gi 18571812     --------------------------
gi 22046917     --------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap