Conserved Protein Domain Family
KOG1406

?
KOG1406: KOG1406 
KOG1406, Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229348
View PSSM: KOG1406
Aligned: 4 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2507456    1 MSSSPWepatlrRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYhSL 80  human
22946777   1 MTKT--------RVYVIGVGMTKFEKPGRRADACYPDFAKEAITKALQDAGIKFEEVQQAVAGYVYGDSTCGQRAIY-EV 71  fruit fly
7298493    1 MSKT--------RVYVVGVGMTKFEKPGRQADVCYPDFAREAITKALQDAGIKYEEVQQAVAGYVYGDSTCGQRAIY-EV 71  fruit fly
17537653   1 MTPTKP------KVYIVGVGMTKFCKPGSVPGWDYPDMVKEAVTTALDDCKMKYSDIQQATVGYLFGGTCCGQRALY-EV 73  Caenorhabditis elegans
2507456   81 GMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFS---DRTIPTDKHVDLLINKYGLSAHP 157 human
22946777  72 GMTGIPVYNVNNNCSTGSSALYLAKQIVESGNSECVLALGFEKMERGSLS------------------------------ 121 fruit fly
7298493   72 GMTGIPVYNVNNNCSTGSSALYLAKQIVESGNADCVLALGFEKMERGSLSSKYF---DRANPMERHITEMGELAEIGAGP 148 fruit fly
17537653  74 GLTGIPIFNVNNACASGSSGLFLGKQIIESGNSDVVLCAGFERMAPGSLENLAApidDRALSVDKHISVMSETYGLEPAP 153 Caenorhabditis elegans
2507456  158 VAPQ-----------------------------MFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDE 208 human
22946777 122 --AKyfdranpmerhitemselteigagpmaaqIFGNAGKEHMKKYGTKPEHFGKIAWKNHKHSVNNPYSQFRDEYTLEQ 199 fruit fly
7298493  149 MAAQ-----------------------------IFGNAGKEHMKKYGTKPEHFGKIAWKNHKHSVNNPYSQFRDEYTLEQ 199 fruit fly
17537653 154 MTAQ-----------------------------MFGNAAKEHMEKYGSKREHYAKIAYKNHLHSVHNPKSQFTKEFSLDQ 204 Caenorhabditis elegans
2507456  209 VMASKEVFD-FLTILQCCPTSDGAAAAILASEAFVQKYG-LQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAAR 286 human
22946777 200 IMKSPQVVEgVLTKLQCCPTSDGSGAAILASEAFVRRHG-LEKQAVEIVGMEMASDPASTFADKSLMKIAGTDMTRLATE 278 fruit fly
7298493  200 IMKSPQVVEgVLTKLQCCPTSDGSGAAILASEAFVRRHG-LEKQAVEIVGMEMASDPASTFADKSLMKIAGTDMTRLATQ 278 fruit fly
17537653 205 VINARKIYD-FMGLLECSPTSDGAAAAVLVSEKFLEKNPrLKAQAVEIVGLKLGTDEPSVFAENSNIKMIGFDMIQKLAK 283 Caenorhabditis elegans
2507456  287 KCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCA 366 human
22946777 279 RLFAKSGYKPQDVQVVELHDCFSANELITYEALGLCGEGKAGEFIDAGDNTYGGKFVVNPSGGLISKGHPLGATGLAQCA 358 fruit fly
7298493  279 RLFAKSGYKPQDVQVVELHDCFSANELITYEALGLCGEGNAGEFIDAGDNTYGGKFVVNPSGGLISKGHPLGATGLAQCA 358 fruit fly
17537653 284 QLWAETKLTPNDVQVIELHDCFAPNELITYEAIGLCPVGQGHHIVDRNDNTYGGKWVINPSGGLISKGHPIGATGVAQAV 363 Caenorhabditis elegans
2507456  367 ELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFR 415 human
22946777 359 ELCWQLRGLAEKRQVPNAQLALQHNLGLGGAVVVALYRLGFPGAAKAKL 407 fruit fly
7298493  359 ELCWQLRGLAEKRQVPNAQLALQHNLGLGGAVVVALYRLGFPAANSVVR 407 fruit fly
17537653 364 ELSNQLRGKCGKRQVPNCKVAMQHNIGIGGAGVVGLYRLGFPGAAQSKI 412 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap