Conserved Protein Domain Family
KOG1394

?
KOG1394: KOG1394 
KOG1394, 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 229336
View PSSM: KOG1394
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5882727   86 FGSNSvslNRNQRRLNRAassggamavmemekeAAVNKKPpteQRRVVVTGMGVETSLGHDPHTFYENLLQGNSGISQIE 165 thale cress
7296703    2 RVLGK---CTVLVRQTRS---------------LSTPSGR----RRVVVTGSGAVTPLGNNGPDSWRRILAGESAISRLS 59  fruit fly
25286583   1 MATSN---LRRHLSASRLrln----------rfISTSSSYh-sHRRVVVTGLGMVTPLGRGVETTWRRLIDGECGIRGLT 66  thale cress
20141399  28 LITNArplRRQQRSFISAsa-----------stVSAPKREtdpKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLID 96  thale cress
7498864    1 -------------------------------------------MHRVVITGMGAISPFGVTVNALRNGLNEGRSGLKYDE 37  Caenorhabditis elegans
8923559   10 KITSTrllCSRLCQQLRSkrk----------ffGTVPISRl--HRRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLV 77  human
19113279   1 -------------------------------------------MKRVVITGLGAVTPLGNGVKTNWRNLIQGKSGIVSLK 37  fission yeast
729100     1 ------------------------------------------mSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPIT 38  baker's yeast
5882727  166 N-FDC--------SEFPTNiflcftfvkrIAGEIKS------FSTEG------WVAPKLSKRMDKFMLYLLTAGKKALAD 224 thale cress
7296703   60 --AEF--------KGLPCQ----------VAAQIPRen--lqLDQH--------LTKSDIKLMSPATQLAVLAAEEALST 109 fruit fly
25286583  67 L-DDL--------KMKSFD----------EETKLYT------FDQLS--------SKVAAFAVANFIGYAVCAADEALRD 113 thale cress
20141399  97 R-FDA--------SKFPTr----------FGGQIRG------FSSEG------YIDGKNERRLDDCLKYCIVAGKKALES 145 thale cress
7498864   38 --------------ILKF-----------VVGAVPG------ERVED------RWSTGQQREMSKASMFVLAASEEALKQ 80  Caenorhabditis elegans
8923559   78 G-EEY--------KSIPCS----------VAAYVPRgsdegqFNEQN------FVSKSDIKSMSSPTIMAIGAAELAMKD 132 human
19113279  38 GfPEY--------EQIPSK----------VAGVIPRgkekeeWNVLD------YVDQGKLREVATFTQLALTSAAEALKD 93  fission yeast
729100    39 SlPNYnedyklreKSIPSTi---------TVGKIPEn-----FQNENsainklLFTSQDERRTSSFIKLALRTTYEALHN 104 baker's yeast
5882727  225 GGVTDEV-----MAEFDKTKCGVLIGSAMGGMKVFYDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSI 298 thale cress
7296703  110 GKLCPKQ-----LSEEELERFGVCVGMGMFDLAEVYG-AWNQLQRgYNRVSPFFVPRLLPSMACGHISMRHGLRGPNHSV 183 fruit fly
25286583 114 AEWLPT-------EEEEKERTGVSIGGGIGSICDIVEAAQLICEKrLRRLSPFFIPKILVNMASGHVSMKYGFQGPNHAA 186 thale cress
20141399 146 ANLGGDK-----LNTIDKRKAGVLVGTGMGGLTVFSEGVQNLIEKgHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSI 220 thale cress
7498864   81 AKAEDV----------DHNETLVNIGTCMSDLEHIGETAQKVSEGqSRRVSPYFVPRILNNLPAGYVAMKYKMRGGVEST 150 Caenorhabditis elegans
8923559  133 SGWHPQ-------SEADQVATGVAIGMGMIPLEVVSETALNFQTKgYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAV 205 human
19113279  94 ARWIDI-------DEQEKLATGVCFGTGIGNLDDALNENGVLNKAgIRKVSPRVISKILINMPAGYISQRYGFTALNHTT 166 fission yeast
729100   105 AGLLNPNditinTSLCNLDHFGCLIGSGIGSIQDIYQTSLQFHND-NKRINPYFVPKILTNMAAGNVSIKFNLRGLSHSV 183 baker's yeast
5882727  299 STACATSNFCILNSANHIIKGEAvsilhtlgnstDVMLCGGSDAVIIPIGLGGFVACRALSQR-NNDPTKASRPWDTNRD 377 thale cress
7296703  184 STACATGAHALGDAMRFIRSGDA-----------DLMLAGSGEACIDPLSIAGFCRLRALSTAfNDNPAVASRPFDKSRD 252 fruit fly
25286583 187 VTACATGAHSIGDATRMIQFGDA-----------DVMVAGGTESSIDALSVAGFSRSRALSTKfNSSPQEASRPFDCDRD 255 thale cress
20141399 221 STACATSNYCFYAAANHIRRGEa-----------DMMIAGGTEAAIIPIGLGGFVACRALSQR-NDDPQTASRPWDKARD 288 thale cress
7498864  151 STACATGLHCIGNSFRSIRYGDS-----------RRALAGAVECALNPIALAGFDRMRALAR--GDQPN-ISRPFDKKRA 216 Caenorhabditis elegans
8923559  206 STACTTGAHAVGDSFRFIAHGDA-----------DVMVAGGTDSCISPLSLAGFSRARALST--NSDPKLACRPFHPKRD 272 human
19113279 167 TTACAAGCHAIGDAFNFIKLGHA-----------DVIIAGGSESCINPLTVAGFSKARSLSTKfNDNPKAASRPFDANRD 235 fission yeast
729100   184 STACATGNNSIGDAFNFIRLGMQ-----------DICVAGASETSLHPLSLAGFIRAKSITT----NG--ISRPFDTQRS 246 baker's yeast
5882727  378 GFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVILCIERALASAGISKEQINYINAHATST 457 thale cress
7296703  253 GFVMGEGAAVLLLEELEHARARGAPILAEILGYGLSGDAYHITSPSDDGAGATLAMKRAIQDAGIAPEDVTYVNAHATST 332 fruit fly
25286583 256 GFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATST 335 thale cress
20141399 289 GFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHATST 368 thale cress
7498864  217 GFVMSEGVGLVFMERLEDAQARGAQILAEVVGYGISSDCYHISTPDPSAIGAVLSMNRAIGNAHLEPKDIGYVNAHATST 296 Caenorhabditis elegans
8923559  273 GFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATST 352 human
19113279 236 GFVIGEGSAALVLEELEHAKNRNAHIYAEIVGYGLASDSYHITAPNPNGDAAYYAMKRSLKQAGLSASQLDYINAHATST 315 fission yeast
729100   247 GFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKRAIEMALKMARLEPTDVDYVNAHATST 326 baker's yeast
5882727  458 HAGDIKEYQALAHCFGQNPEL----KVNSTKSMIGHLLGAAGAVEAVATVQAIRTGWVHPNINLENPDS--GVDTK---L 528 thale cress
7296703  333 PTGDRIESHAIGRVFGAHTPQv---RVSSTKGAHGHLLGSSGNLEALFVVLACANNKLPPSINIEHLD----VDVNv-vT 404 fruit fly
25286583 336 PIGDAVEARAIKTVFSEHATSgt-lAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDP--IFDKRfmpL 412 thale cress
20141399 369 LAGDLAEINAIKKVFKSTSGI----KINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQ--AVDFD---T 439 thale cress
7498864  297 PNGDSVEAEAVRQVFPEQNIA-----VSSVKGHIGHLLGAAGSVEAIATIFAMNDDVLPANRNLEETDEgnGLNLLrenQ 371 Caenorhabditis elegans
8923559  353 PLGDAAENKAIKHLFKDHAYAl---AVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEP--EFDLNyvpL 427 human
19113279 316 KLGDVAESIAITRLLCDVNRNpeafPVSSSKGSIGHLLGAAGAIESVYTVLTVQKGVLPPTLNFEYSDIpqQFQCDyvpN 395 fission yeast
729100   327 LLGDKAECLAVASALLPGRSKskplYISSNKGAIGHLLGAAGAVESIFTICSLKDDKMPHTLNLDNVLTleNNEADklhF 406 baker's yeast
5882727  529 LVGPKKERLDIKAALSNSFGFGGHNSSIIFAPYK 562 thale cress
7296703  405 KATDWSADQKRRVALKNSFGFGGTNASLCIASYI 438 fruit fly
25286583 413 TTSKKML---VRTAMSNSFGFGGTNASLLFASI- 442 thale cress
20141399 440 VPNEKKQ-HEVDVAISNSFGFGGHNSVVAFSAFK 472 thale cress
7498864  372 KWSDVSG-NKSRISICNSFGFGATNASLILKQF- 403 Caenorhabditis elegans
8923559  428 KAQEWKT-EKRFIGLTNSFGFGGTNATLCIAGL- 459 human
19113279 396 VAKESRIN----VALSNSFGFGGTNASLCFKKFL 425 fission yeast
729100   407 IRDKPIVGANPKYALCNSFGFGGVNTSLLFKKWE 440 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap