Conserved Protein Domain Family
KOG1393

?
KOG1393: KOG1393 
KOG1393, Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229335
View PSSM: KOG1393
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1708239    6 PLNAEACWPK-DVGIVALEIYF-------------PSQYVDQAELEKYDGVDAGKYTIGLGQAKMG-------FCTDRED 64  human
7302938    1 ---MASHWPE-NVGIRAIEILF-------------PSQYVDQTELETFDGASAGKYTIGLGQAKMG-------FCSDRED 56  fruit fly
21431772   1 ----MAK----NVGILAMDIYF-------------PPTCVQQEALEAHDGASKGKYTIGLGQDCLA-------FCTELED 52  thale cress
21542411   2 SLGQLSYTPVtDVGIGAIELYF-------------PQNFVDQNDLEKFNNVSSGKYTIGLGQQQMG-------FCSDNED 61  Caenorhabditis elegans
19074660   1 --MPAKN----MFGIIGVEYQL-------------PSLYISQEEVANNIDFEVDKIKIGLGLEQMG-------VPSRRED 54  Encephalitozoon cun...
17449881   1 MLGASSNWSW-DNAAIQVKCRTrnkrmagepekgdPMGSPEKGDPEKGDPREDWAHGLGLQGVQLSgagraaeVATEPPD 79  human
1708234   43 PLAKTDTWPK-DVGILALEVYF-------------PAQYVDQTDLEKYNNVEAGKYTVGLGQTRMG-------FCSVQED 101 human
1708240    1 MSFDRK-----DIGIKGLVLYT-------------PNQYVEQAALEAHDGVSTGKYTIGLGLTKMA-------FVDDRED 55  fission yeast
1708241   38 KTAEQKTRPQ-NVGIKGIQIYI-------------PTQCVNQSELEKFDGVSQGKYTIGLGQTNMS-------FVNDRED 96  baker's yeast
1708239   65 -INSLCMTVVQ-NLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNW 142 human
7302938   57 -VNSLCLTVVS-RLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNW 134 fruit fly
21431772  53 -VISMSFNAVT-SLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTAALLNCVNW 130 thale cress
21542411  62 -IVSISLTVTR-KLIETYKISTDSIGCLVVGTETMIDKSKSVKTALMDLFP--GNSDIEGVDIKNACFGGAQALLHAIDW 137 Caenorhabditis elegans
19074660  55 -AISLALNAVS-RLMKRYNVDPMAIGRLEVGTESNPDGSKSIKSYLTDLFP--GNTSICGCDNVHACYSGTNALLSAIAW 130 Encephalitozoon cun...
17449881  80 pVPAPNRTRSQeNLMERKNLSYDCTGRLEVGTETIKDKSKSVKTNLMQLFEESGDIDIEGTDTTHACYGAPAAVFSAVNW 159 human
1708234  102 -INSLCLTVVQ-RLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANW 179 human
1708240   56 -IYSFGLTALS-QLIKRYQIDISKIGRLEVGTETIIDKSKSVKSVLMQLFG--DNHNVEGIDCVNACYGGVNALFNTIDW 131 fission yeast
1708241   97 -IYSMSLTVLS-KLIKSYNIDTNKIGRLEVGTETLIDKSKSVKSVLMQLFG--ENTDVEGIDTLNACYGGTNALFNSLNW 172 baker's yeast
1708239  143 IESSS-WDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKP--DMLSEYPIVDGK 219 human
7302938  135 VESSS-WDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKP--DLSSEYPTVDGK 211 fruit fly
21431772 131 VESNS-WDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLRASHMAHVYDFYKP--NLASEYPVVDGK 207 thale cress
21542411 138 VTVNHpLDKKNAIVVVADIAIYEEGPARCTGGAGAIAFLICPDASIPIDRQFSACHMKNTWDFFKPitPIPSEYPVVDGS 217 Caenorhabditis elegans
19074660 131 MESSF-WDGRLAIVVASDVAMYKDKSCQPTGGAGAVAILLGPNCIYRVVPSSVIHYFTNQFDFMKP--RELHPFPVVKGK 207 Encephalitozoon cun...
17449881 160 IESSS-WDGQFALEFVGDIAVYPTGKVRLTGRVRAVALLIEPNATLIFERGLRGTHMQRAYGFYEP--DMLSECPIVDGK 236 human
1708234  180 MESSS-WDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKP--NLASEYPIVDGK 256 human
1708240  132 IESSA-WDGRDGIVVAGDIALYAKGNARPTGGAGCVALLVGPNAPIVFEPGLRGTYMQHAYDFYKP--DLTSEYPYVDGH 208 fission yeast
1708241  173 IESNA-WDGRDAIVVCGDIAIYDKGAARPTGGAGTVAMWIGPDAPIVFDS-VRASYMEHAYDFYKP--DFTSEYPYVDGH 248 baker's yeast
1708239  220 LSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKdf---tLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIys 296 human
7302938  212 LSIQCYLSALDTCYRLYRKKFDQQQKDT-SKQpa---sLSTFDAILFHTPFCKLVQKSVGRLSFNDFLLSSEEERTKQfp 287 fruit fly
21431772 208 LSQTCYLMALDSCYKHLCNKFEKIEGKEFSIN--------DADYIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAke 279 thale cress
21542411 218 LSLSSYLEAVRMTYTYFISKVNRHTTGIDGLN--------SFDGVFLHSPFTKMVQKGLAVMNYTDSQLRHKQLNGN--- 286 Caenorhabditis elegans
19074660 208 ESIENYRTAFEICYGRFREKMAEES---------------SFDYIVLHSPYTRLPEK----------------------- 249 Encephalitozoon cun...
17449881 237 PSTQCCFSALDHCYSVDCKTIRAQWQKDGNDKdf---tLNNFGFLILHSPYC---------------------------- 285 human
1708234  257 LSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRpf---tLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLyk 333 human
1708240  209 FSLECYVKALDGAYANYNVRDVAKNGKSQGLG------LDRFDYCIFHAPTCKQVQKAYARLLYTDSAAEPSN-PELEgv 281 fission yeast
1708241  249 FSLTCYVKALDQVYKSYSKKAISKGLVSDPAGsdalnvLKYFDYNVFHVPTCKLVTKSYGRLLYNDFRANPQLFPEVD-- 326 baker's yeast
1708239  297 GLEafGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKR-IGVFSY 375 human
7302938  288 DLErfNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKR-IGLFSY 366 fruit fly
21431772 280 KFTpySSLTLDESYQSRDLEKVSQQIAKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHKK-HNDLAGKR-VVMFSY 357 thale cress
21542411 287 G----VDHKLDEN--DRAGLAKMIELSAQVWKEKTDPYLVFNRRIGNMYTPSLFAQLLAYLAAD--DCVTGEKsILFFAY 358 Caenorhabditis elegans
19074660 250 -----------------------ICIANHIDRKKLLRSLEASRRNGNAYSASLYLSLISLLECH--DGEVGEK-ILMFSY 303 Encephalitozoon cun...
17449881 286 --------------------------KL-----KTKASLLYP-VKMEIRTHRQYMVPRNCPSAVLTSAMIREE-TGVFSY 332 human
1708234  334 GLEafGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSR-IGAFSY 412 human
1708240  282 RELl-STLDAKKSLTDKALEKGLMAITKERFNKRVSPSVYAPTNCGNMYTASIFSCLTALLSRVPADELKGKR-VGAYSY 359 fission yeast
1708241  327 AEL--ATRDYDESLTDKNIEKTFVNVAKPFHKERVAQSLIVPTNTGNMYTASVYAAFASLLNYVGSDDLQGKR-VGLFSY 403 baker's yeast
1708239  376 GSGLAATLYSLKVTQDATPgsaLDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIP--QGSIDSLFEGTW 453 human
7302938  367 GSGLAASMYSISVTQDAAA---FEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTP--TGSISALFPGTY 441 fruit fly
21431772 358 GSGSTATMFSLRLNDNKPPf--SISNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTtkEGIIDLLAPGTY 435 thale cress
21542411 359 GSGLASAIFPGRVRQTSN----LDKIRQVAIRAIKRLDDRIQFTPEEFTETLQKRE-VFLRSKEIPk-SPSETSLFPNTY 432 Caenorhabditis elegans
19074660 304 GSGASSSMFCLERIS----------KGCMVTGFRERLLERKEISYQEFTKILEEPV---PQDNYEA-----QERIYSPGY 365 Encephalitozoon cun...
17449881 333 GSGSAATLYSLKVPPDATPwsaVDKITASLWDLKSRCSSRTCVVPDVFVENMKLREDTHHLVNSVP--RGPRDSLFEETW 410 human
1708234  413 GSGLAASFFSFRVSQDAAPgspLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSP--PGDTNSLFPGTW 490 human
1708240  360 GSGLAASFFSFVVKG-------DVSEIAKKTNLVNDLDNRHCLTPTQYEEAIELRHQAHLKKNFTP--KGSIERLRSGTY 430 fission yeast
1708241  404 GSGLAASLYSCKIVG-------DVQHIIKELDITNKLAKRITETPKDYEAAIELRENAHLKKNFKP--QGSIEHLQSGVY 474 baker's yeast
1708239  454 YLVRVDEKHRRTYARRPTPNDDTL 477 human
7302938  442 YLKDVDALHRRTYERTPTISNGVH 465 fruit fly
21431772 436 YLKEVDSLYRRFYGKKGEDGSVAN 459 thale cress
21542411 433 FLDNMDKLYRRSYTLHEEPNGVQN 456 Caenorhabditis elegans
19074660 366 YLKRISSFARYYEYLTE------- 382 Encephalitozoon cuniculi
17449881 411 YLAMVGEKHRRSYTPCPSPNNDTW 434 human
1708234  491 YLERVDEQHRRKYARRPV------ 508 human
1708240  431 YLTGIDDMFRRSYSVKP------- 447 fission yeast
1708241  475 YLTNIDDKFRRSYDVKK------- 491 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap