Conserved Protein Domain Family
KOG1392

?
KOG1392: KOG1392 
KOG1392, Acetyl-CoA acetyltransferase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229334
View PSSM: KOG1392
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1706566   9 KNLPTASKWALRFSIRPLSCSSQLRaapAVQTKTKKTLAKP-NIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGL 87  human
7291661   1 MSLQNVCRKGNAFNLLNVARKVQCR---ALSAAVANPQPKQkNSQNIVLVDGVRTPFLTSGTTYSKLMPHELARHSLLSL 77  fruit fly
465684    1 -------------MLRAVST--------SFGTARAASAVAKkNMPNIVLVDAVRTPFVVSGTVFKDLMAVDLQKEAIKAL 59  Caenorhabditis elegans
1706566  88 LHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVEL 167 human
7291661  78 LQKNRLDKELIDYIVYGSVIQEVKTSNIAREAALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEF 157 fruit fly
465684   60 VEKTKLPYEQLDHIICGTVIQECKTSNIAREAALLAGVPDKIPAHTVTLACISSNVAMTTGMGMLATGNANAIIAGGVEL 139 Caenorhabditis elegans
1706566 168 MSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALR 247 human
7291661 158 MSDVPIRHSRKMRSLLLKANKAKTLGQRLALLSTFRPDFLAPELPAVAEFSSGETMGHSADRLASAFNVSRSEQDEYALR 237 fruit fly
465684  140 LSDVPIRYNRNARKAMLGMNKAKDVPSKLKIGGQIVKNLLSPELPAVAEFSTGETMGHSGDRLAAAFNVSRREQDEFAIR 219 Caenorhabditis elegans
1706566 248 SHSLAKKAQDEGLLSDVVPFKVPGKDTVT--KDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEK 325 human
7291661 238 SHTLAKEAQEKGYFTDLVPFKVSGVDQIVd-KDNGIRVSSPESLAKLRPAFVKPYGTVTAANASFLTDGASACIIMTEEK 316 fruit fly
465684  220 SHTLASEAAKNGKFTDVVPVFLDGKKPKTikEDNGIRVSTLEKLSSLKPAFVKPHGTVTAANASYLTDGASAALIMTEEY 299 Caenorhabditis elegans
1706566 326 ALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGR 405 human
7291661 317 AKQLGLKPKAYLRDFLFVSQDPVNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCKTYLGL 396 fruit fly
465684  300 ALANGYKPKAYLRDYLYVAQDPKDQLLLSPAYVIPKLLDKAGLTLKDVDVFEIHEAFAGQVLANLNAMDSDYFCKEQMKR 379 Caenorhabditis elegans
1706566 406 KTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK 474 human
7291661 397 NEKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAAGGQGVAMLIERYPG 465 fruit fly
465684  380 SGKFGRVPMDKLNLWGGSLSIGHPFGATGVRLATHSAHRLKEEKGQYAVIAACAAGGHGVGMLIEAYGK 448 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap