Conserved Protein Domain Family
KOG1390

?
KOG1390: KOG1390 
KOG1390, Acetyl-CoA acetyltransferase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229332
View PSSM: KOG1390
Aligned: 12 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
8777413   89 ESVNPR----DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRA-NVDPA-LVQEVVFGNVLSANLGQAPARQAA 162 thale cress
7290840   16 RNYSSKi--aEVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKA-GIAKT-DVQEVIMGNVVSAGLGQAPARQAA 91  fruit fly
23092751   1 ----MS----DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRA-NVEGQ-EVNEVILG---------------- 54  fruit fly
15238793   8 DSLQPR----DVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRA-HVDPA-LVEEVFFGNVLTANLGQAPARQAA 81  thale cress
17535917  95 AALSNK----DAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGaVKPSSiQEANVFLGQVCHANAGQASARQAA 170 Caenorhabditis elegans
17535921   1 --MSDK----KVFILSGARTPIGAYRGSFANFGAVELGTVAAKAAIERSgVAPEKiEE--VIGGCVLPAGLGQNVTRQIS 72  Caenorhabditis elegans
7433655   17 AALSNK----HAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGaVKPSSiQEASVFLGQVCQANAGQAPARQAA 92  Caenorhabditis elegans
135755    31 RSYVSKptlkEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKA-GIPKE-EVKEAYMGNVLQGGEGQAPTRQAV 108 human
5174389    1 MNAGSD----PVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRA-TVAPE-DVSEVIFGHVLAAGCGQNPVRQAS 74  human
19113478   1 --MVNT----EVYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERV-NIKPS-DVDEVFMGNVVSANLGQNPARQCA 72  fission yeast
730943     1 ---MSQ----NVYIVSTARTPIGSFQGSLSSKTAVELGAVALKGALAKVpELDASkDFDEIIFGNVLSANLGQAPARQVA 73  baker's yeast
12653279   1 MNAGSD----PVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRA-TVAPE-DVSEVIFGHVLAAGCGQNPVRQAS 74  human
8777413  163 LGAGIPNS-----------------------VICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPkYLAE 219 thale cress
7290840   92 IFAGLPTN-----------------------VCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVP--YYL 146 fruit fly
23092751  55 -------QalsagqgqnparqaslkaglpiqVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAP-HVMH 126 fruit fly
15238793  82 LGAGIPYS-----------------------VICTTINKVCAAGMKSVMLASQSIQLGLNDIVVAGGMESMSNVPkYLPD 138 thale cress
17535917 171 LGAGLDLS-----------------------VAVTTVNKGWSSGMKAIILAAQQIQTGHQDLAIGGGMESMSQVP--FFL 225 Caenorhabditis elegans
17535921  73 LSAGLPVT-----------------------TQAVTVNKVCSSSMKALVTAAVEIKAGYYDTILVVGTENMSQVP--FYV 127 Caenorhabditis elegans
7433655   93 LGAGLDLS-----------------------VAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVP--FYV 147 Caenorhabditis elegans
135755   109 LGAGLPIS-----------------------TPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVP--YVM 163 human
5174389   75 VGAGIPYS-----------------------VPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAP-HLAY 130 human
19113478  73 LGAGLPRS-----------------------IVCTTVNKVCASGMKATILGAQTIMTGNAEIVVAGGTESMSNAPyYAPK 129 fission yeast
730943    74 LAAGLSNH-----------------------IVASTVNKVCASAMKAIILGAQSIKCGNADVVVAGGCESMTNAPyYMPA 130 baker's yeast
12653279  75 VGAGIPYS-----------------------VPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAP-HLAY 130 human
8777413  220 ARKGSRFGHDSLVDGMLKDGLWDVYNDCGMGSCAELCAEKFQITREQQDDYAVQSFERGIAAQEAGAFTWEIVPVEVSGG 299 thale cress
7290840  147 KRGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVFQDEIAPVKIQQK 226 fruit fly
23092751 127 LRQGVKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKEIVPVEIKDR 206 fruit fly
15238793 139 ARRGSRLGHDTVVDGMMKDGLWDVYNDFGMGVCGEICADQYRITREEQDAYAIQSFERGIAAQNTQLFAWEIVPVEVSTG 218 thale cress
17535917 226 ARVEQSSNKYQVEQ-TVQDGISDFFDKQELCINGERT---------------------------NGNIGPEVVAVNVKSK 277 Caenorhabditis elegans
17535921 128 PRGEIPFGGIQMTDGISKDGLEDIKEKGPMGLCAEKTVKDYGITREEQDAYAIESYKKASNAWSSEKFSEEVVPVSVKTS 207 Caenorhabditis elegans
7433655  148 QRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSK 227 Caenorhabditis elegans
135755   164 NRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVK 243 human
5174389  131 LRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVATKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR 210 human
19113478 130 NRFGAKYGNVELVDGLLRDGLSDAYDGLPMGNAAELCAEEHSIDRASQDAFAISSYKRAQNAQATKAFEQEIVPVEVPVG 209 fission yeast
730943   131 ARAGAKFGQTVLVDGVERDGLNDAYDGLAMGVHAEKCARDWDITREQQDNFAIESYQKSQKSQKEGKFDNEIVPVTIKGF 210 baker's yeast
12653279 131 LRTGVKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR 210 human
8777413  300 RGrpSTIVDKDEGLGK-FDAAKLRKLRPSFKENGG-TVTAGNASSISDGAAALVLVSGEKALQLGLLVLAKIKGYGDAAQ 377 thale cress
7290840  227 RKp-EIVISEDEEYKR-VNFDKFGQLATVFQRENG-TVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAET 303 fruit fly
23092751 207 KG--TTTFSKDEYIKAgSTVEGIQKLRAAFKEGGS--ITAGNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGI 282 fruit fly
15238793 219 RGrpSVVIDKDEGLGK-FDAAKLKKLRPSFKEDGG-SVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQ 296 thale cress
17535917 278 KG--VEAVKQDD-ITKiKKIKEGSVYSSIPIFPGg-TISDKHIAAFTDGAAAVILASQEAVSEQNLKPLARILAYGDAAT 353 Caenorhabditis elegans
17535921 208 RS--EVVITEDEEYKKlIESKVSSLKP-VFVRDGTgTITPANASSLNDGAVATVVVGENALP-QGAHPLAELVAFAEAGR 283 Caenorhabditis elegans
7433655  228 KG--VTIVDKDEEFTKvNFDKFTSLRT---VFQKDgTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAAT 302 Caenorhabditis elegans
135755   244 GQp-DVVVKEDEEYKR-VDFSKVPKLKTVFQKENG-TVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAV 320 human
5174389  211 KG--LIEVKTDEFPRHgSNIEAMSKLKPYFLTDGTgTVTPANASGINDGAAAVALMKKSEADKRGLTPLARIVSWSQVGV 288 human
19113478 210 RGkpNKLVTEDEEPKN-LNEDKLKSVRAVF-KSNG-TVTAANASTLNDGASALVLMSAAKVKELGLKPLAKIIGWGEAAQ 286 fission yeast
730943   211 RGkpDTQVTKDEEPAR-LHVEKLRSARTVFQKENG-TVTAANASPINDGAAAVILVSEKVLKEKNLKPLAIIKGWGEAAH 288 baker's yeast
12653279 211 RG--LIEVKTDEFPRHgSNIEAMSKLKPYFLTDGTgTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGV 288 human
8777413  378 EPE-------------FFTTAPALAIPKAIAHAGLE-SSQVDYYEINEAFAVVALANQKLLGIAPEKVNVNGGAVSLGHP 443 thale cress
7290840  304 DPI-------------DFPIAPALAIPKLLKRAGVR-KEDVAMWEVNEAFSLVVLANIKKLDVDPAKVNVHGGAVSIGHP 369 fruit fly
23092751 283 EPKvmglgpvtavealLQKIN-------------WK-REEVDLYELNEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHP 348 fruit fly
15238793 297 APE-------------LFTTTPALAIPKAIKRAGLD-ASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHP 362 thale cress
17535917 354 HQL-------------DFAVAPTLLFPNLLQSAGVE-QSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHP 419 Caenorhabditis elegans
17535921 284 API-------------DFTVAPVDAVRLLLKKSGLQ-VSDIALWELNEAFAVTVLAFIKELNIEPSVVNVKGGAVAIGHP 349 Caenorhabditis elegans
7433655  303 HPL-------------DFAVAPTLMFPKILERAGVK-QSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHP 368 Caenorhabditis elegans
135755   321 EPI-------------DFPIAPVYAASMVLKDVGLK-KEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHP 386 human
5174389  289 EPS-------------IMGIGPIPAIKQAVTKAGWS-LEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHP 354 human
19113478 287 DPE-------------RFTTSPSLAIPKALKHAGIE-ASQVDYYEINEAFSVVAVANTKILGLDPERVNINGGGVAMGHP 352 fission yeast
730943   289 QPA-------------DFTWAPSLAVPKALKHAGIEdINSVDYFEFNEAFSVVGLVNTKILKLDPSKVNVYGGAVALGHP 355 baker's yeast
12653279 289 EPS-------------IMGIGPIPAIKQAVTKAGWS-LEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHP 354 human
8777413  444 LGCSGARILITLLGILKKRNGKYGVGGVCNGGGGASALVLELL 486 thale cress
7290840  370 IGMSGARLVAHLSHSLKK--GELGCASICNGGGGASSILIEKL 410 fruit fly
23092751 349 IGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVERL 391 fruit fly
15238793 363 LGCSGARILVTLLGVLRAKKGKYGVASICNGGGGASALVLEFM 405 thale cress
17535917 420 IGMSGASLITHLVHTLES--GQIGVAALCDGDGGSSGMVIQKL 460 Caenorhabditis elegans
17535921 350 LGMSGLRIVNSLAYSLAP--GQLGVAAICNGGGEATAVLIKKL 390 Caenorhabditis elegans
7433655  369 IGMSGARLITHLVHTLKS--GQIGVAAICNGGGGSSGMVIQKL 409 Caenorhabditis elegans
135755   387 IGMSGARIVGHLTHALKQ--GEYGLASICNGGGGASAMLIQKL 427 human
5174389  355 LGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE 397 human
19113478 353 LGSSGSRIICTLAYILAQKDAKIGVAAVCNGGGGASSIVIERV 395 fission yeast
730943   356 LGCSGARVVVTLLSILQQEGGKIGVAAICNGGGGASSIVIEKI 398 baker's yeast
12653279 355 LGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE 397 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap