Conserved Protein Domain Family
KOG1389

?
KOG1389: KOG1389 
KOG1389, 3-oxoacyl CoA thiolase [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229331
View PSSM: KOG1389
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225798   4 AIERQRVLLEHLRPSSSSshn---yeASLSASACLAGDSAAYQrtslygDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLA 80  thale cress
15219797   4 ATERQRILLRHLQPSSSSd-------ASLSASACLSKDSAAYQy----gDDVVIVAAQRTALCKAKRGSFKDTFPDELLA 72  thale cress
30695564   4 AMERQKILLRHLNPVSSSnsslkhepSLLSPVNCVSEVSPMAAf----gDDIVIVAAYRTAICKARRGGFKDTLPDDLLA 79  thale cress
19074344   1 ---------------------------------------MISH------EDVVVVGALRTPIGRATRGKLRSLRNDELVT 35  Encephalitozoon cun...
135751     1 -MQRLQVVLGHLRGPADSg-------WMPQAAPCLSGAPQASA------ADVVVVHGRRTAICRAGRGGFKDTTPDELLS 66  human
135753     1 MSQRLQSIKDHLVESAMG---------KGESKRKN-SLLEKRP------EDVVIVAANRSAIGKGFKGAFKDVNTDYLLY 64  baker's yeast
15225798  81 PVLRALI----EKTNLNPSEVGDIVVGTVLAPGSQrASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGF 156 thale cress
15219797  73 SVLRALI----EKTNVNPSEVGDIVVGTVLGPGSQrASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGF 148 thale cress
30695564  80 SVLKAVV----ERTSLDPSEVGDIVVGTVIAPGSQrAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGY 155 thale cress
19074344  36 AAIRGII----EKTGIDPRLIEEVILGHCLSSMEG-NVAARMGVLRAGVPVETPVMIINRLCGSGLESVGLIAEKIRSGR 110 Encephalitozoon cun...
135751    67 AVMTAVL----KDVNLRPEQLGDICVGNVLQPGAG-AIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGS 141 human
135753    65 NFLNEFIgrfpEPLRADLNLIEEVACGNVLNVGAG-ATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQ 143 baker's yeast
15225798 157 YDIGIGAGLESMTTN--PMAWEGSVNPA-VKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGK 233 thale cress
15219797 149 YDIGIGAGLESMTTN--PRGWKGSVNPN-VKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGK 225 thale cress
30695564 156 YDIGIGAGVESMSTDhiPGGGFHGSNPR-AQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESHKRAAAAIASGK 234 thale cress
19074344 111 IEIGLAGGFESMTSY----GLPKEYTLSrGGACEDAEDCMLTLGEVSEMLGKTHGVTRSEADEYAVTSQKRALEATKKGH 186 Encephalitozoon cun...
135751   142 YDIGMACGVESMSLAd--RGNPGNITSR-LMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGC 218 human
135753   144 IDIGLALGVESMTNNykNVNPLGMISSEeLQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGL 223 baker's yeast
15225798 234 FKDEIIPVKTKLVDPKtGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKD-GTTTAGNSSQVSDGAGAVLLMKRSVAMQK 312 thale cress
15219797 226 FKDEITPVKTKIVDPKtGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKED-GTTTAGNSSQLSDGAGAVLLMRRNVAMQK 304 thale cress
30695564 235 LKDEIIPVATKIVDPEtKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQN-GSTTAGNASQISDGAGAVLLMKRSLAMKK 313 thale cress
19074344 187 FLAEIIPM--RVGDET-------VER-DEGIR-ETSLGTIESLKPVFRQD-GVCTSANSSQLSDGASAVLLMKRRRADEL 254 Encephalitozoon cun...
135751   219 FQAEIVPVTTTVHDDK-GTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKD-GSTTAGNSSQVSDGAAAILLARRSKAEEL 296 human
135753   224 FEDEILPI--KLPDGS-------ICQSDEGPRPNVTAESLSSIRPAFIKDrGTTTAGNASQVSDGVAGVLLARRSVANQL 294 baker's yeast
15225798 313 GLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIG 392 thale cress
15219797 305 GLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIG 384 thale cress
30695564 314 GLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIG 393 thale cress
19074344 255 GLPVVAEFIDFIAVGLKPRDMGLGPVVAIEKLLKRNGLEKDQISYFEINEAFASQVLCCLRKLQIGEDRVNRYGGSIALG 334 Encephalitozoon cun...
135751   297 GLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALG 376 human
135753   295 NLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGAIALG 374 baker's yeast
15225798 393 HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARK 450 thale cress
15219797 385 HPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRK 442 thale cress
30695564 394 HPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARV 451 thale cress
19074344 335 HPIGASGARIVCTLLSVMKNEALEG-YGVASLCVGAGHGVAALFRRAAGSKPQDIKNT 391 Encephalitozoon cuniculi
135751   377 HPLGCTGARQVITLLNELKRRGK-RAYGVVSMCIGTGMGAAAVFEYPGN--------- 424 human
135753   375 HPLGCTGARQVATILRELKKDQI---G-VVSMCIGTGMGAAAIFIKE----------- 417 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap