Conserved Protein Domain Family
KOG1270

?
KOG1270: KOG1270 
KOG1270, Methyltransferases [Coenzyme transport and metabolism]
Statistics
?
PSSM-Id: 229212
View PSSM: KOG1270
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12052971  62 KSYRTIFSC--LNRIKSFRYPWAR-----LYSTSQTTVDS--GEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIR--D 130
gi 21264383  39 TSDTDASAAsfSSSHPKIQTLEGKasnksRSTSSTTSLNE--DELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIR--S 114
gi 15234905  37 TVVAASVTDlaGVDSTTIAVLGGGs---vAALAAMVSLTDp-ERRRKLQAEEVGGGDKEVVREYFNSTGFERWRKIYgeT 112
gi 17543762   1 ---MIPSRS--ARIIAKLQRLHST-----TSAASVSSIDV--KEVEKFGDLSAEWADELGPFHALHSLNRIRVPWIV--D 66
gi 17367011   3 KSYRTIFSC--LNRIKSFRYPWAR-----LYSTSQTTVDS--GEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIR--D 71
gi 19113493   1 ------MSDivYANVSHYNKIEASk----YDNPSTLAISK----VISSKILQFEDNSETSLRHDLPKYDQDRLLLTS--D 64
gi 7673982    1 ---MNILNK--VKNVKSYTRLVRQg---fLSQQRNHSVSV--NEVDHFNELAKTWWDWDGGSRLLHLMNSTRLDFMT--E 68
gi 116930     1 MGFIMLLRSrfLKVIHVRKQLSACsrfaiQTQTRCKSTDAseDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQ--R 78
gi 22946973   1 ---mmrnallvsgklrhllscsigrnstrssstaksldagtqkevrhhenhasewwnqngtMGALHALNEIRVPFIR--D 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12052971 131 NLLKTIPN-----HQPG-----------------------KPLLGMK-----ILDVGCGGGLLTEPLGRLG--ASVIGID 175
gi 21264383 115 TLCRHFSK------DPSs---------------------aKPFEGLK-----FIDIGCGGGLLSEPLARMG--ATVTGVD 160
gi 15234905 113 DEVNRVQKdirlgHAKTven-----------------tmlMLTEDRSlagvtVCDAGCGTGLLSIPLAKEG--AIVSASD 173
gi 17543762  67 NVRKSD-Q-----KAPP----------------------------R------LVDVGSGGGLLSIPLARSG--FDVTGID 104
gi 17367011  72 NLLKTIPN-----HQPG-----------------------KPLLGMK-----ILDVGCGGGLLTEPLGRLG--ASVIGID 116
gi 19113493  65 DDLTNVNN-----FWKKs--------------------------GMS-----ILDFACGTGLISQHLFPYC--KQIVGID 106
gi 7673982   69 VFRERN-------CFSG----------------------------KK-----ILDIGCGGGILSESMARLG--ASVTAVD 106
gi 116930    79 TVRNQVKIqnpeiFVPGfnykeflpeyvcdniqremqesiETNLDKRpe-vsVLDVGCGGGILSESLARLKwvKNVQGID 157
gi 22946973  76 GIVSRG-T-----VKPGyvn------------------ttKVLLGQN-----ILEVGCGGGLLTEHLARLG--AQVAGID 124
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12052971 176 PVDEDIKTAQCH-KSFDPVLDKRIEYRVCSLEEIVEETAET------FDAVVASEVVEHVIDLETFLQCCCQVLKPG-GS 247
gi 21264383 161 AVDKNVKIARLH-ADMDPVTST-----IEYLCTTAEKLADEgr---kFDAVLSLEVIEHVANPAEFCKSLSALTIPN-GA 230
gi 15234905 174 ISAAMVAEAEMKaKAQLPSENLP----K-FEVNDLESLTGK------YDTVVCLDVLIHY--PQNKADGMIAHLASL--- 237
gi 17543762 105 ATKQAVEAANQS-LTAKPLQIAGISKRLRFEHTSVEDFCQKphnksaYDAVVASEIVEHVADLPGFIGCLAELARPG-AP 182
gi 17367011 117 PVDENIKTAQCH-KSFDPVLDKRIEYRVCSLEEIVEETAET------FDAVVASEVVEHVIDLETFLQCCCQVLKPG-GS 188
gi 19113493 107 VSQDMVDVYNEKfRKMNIPKERACAYVLSLDDLDGNGDEPFst---eFDAVVCSMAYHHIKDLQEVTNKLSKLLKPN-GR 182
gi 7673982  107 ASPMAIEVAKKH-ASLDPVLNG----RLEYIHGSVEGSQLPt----tFDVVTCMEVLEHVEQPRDFLFSLMEKVKPN-GR 176
gi 116930   158 LTRDCIMVAKEH-AKKDPMLEG----KINYECKALEDVTGQ------FDIITCMEMLEHVDMPSEILRHCWSRLNPEkGI 226
gi 22946973 125 LGEKLIEAAREHlKCSSPELASNVVYKIEPVDQHAKANCEC------YDAVIVSEVLEHVKDKVSLLEASVRSLKPG-GS 197
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 12052971 248 LFITTINKTQLSYALGIVFSEQIAS-IVPKGTHTWEKFVSPETLESILES---------------------N---GLSVQ 302
gi 21264383 231 TVLSTINRTMRAYASTIVGAEYILR-WLPKGTHQWSSFVTPEEMSMILQR---------------------A---SVDVK 285
gi 15234905 238 ----AEKRVILSFAPKTFYYDILKR--------IGELFPGPSKATRAYLH---------------------S---EADVE 281
gi 17543762 183 LFITTINRTWLSKLAAIWLAENVLK-IVPPGVHDWEKFITPAELTSHLEK---------------------A---GCRVT 237
gi 17367011 189 LFITTINKTQLSYALGIVFSEQIAG-IVPKGTHTWEKFVSPETLESILES---------------------N---GLSVQ 243
gi 19113493 183 LFVADLIKGGDTFHGNLHPDEIAKLgVAHHGGFTPQSILNLFKNASLSNA---------------------EvigKAQAN 241
gi 7673982  177 LVLSTISRTLLARLLTITLAEHVLR-IVPVGTHTFEKFIRADELSNFLKE---------------------Q---NWIIN 231
gi 116930   227 LFLSTINRDLISWFTTIFMGENVLK-IVPKGTHHLSKYINSKEILAWFND---------------------NysgQFRLL 284
gi 22946973 198 IFITTLNKTIPSWFGGVLLSEYVLN-LVPRGTHHWDKMISPLDVQRILDTskfisgfifrlgyslfsrssaV---NCQTV 273
                       330       340       350
                ....*....|....*....|....*....|....*..
gi 12052971 303 TVVGMLYNPFSGYWHWSENTSLNYAAHAVKSRVQEHP 339
gi 21264383 286 EIAGFVYNPITGRWLLSDDISVNYIAYGTKRKDLGDI 322
gi 15234905 282 RALGKVGWKISKRGLTTTQFYFSRLIEAVPM------ 312
gi 17543762 238 AVHGLMFHPVGNHWTWIESTQCNYGILAVKN------ 268
gi 17367011 244 TVVGMLYNPFSGYWHWSENTSLNYAAHAVKSRVQEHP 280
gi 19113493 242 VWVDEAKYQRSTQSKDAKTLDLANGEKLYEVKLQLMV 278
gi 7673982  232 DIRGVCYNPLKQQWTLDKPGSSGLGLSCNYFLSAQKP 268
gi 116930   285 DLKGTMYLPYQG-WVEHDCSDVGNYFMAIQRLN---- 316
gi 22946973 274 LVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQREYN 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap