Conserved Protein Domain Family
KOG1202

?
KOG1202: KOG1202 
KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]
Statistics
?
PSSM-Id: 229144
View PSSM: KOG1202
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093    1 MDPTQWWQK----------QDDIVISGVSGRFPRCDN--VKMFGDMLLAGEDLVTEDSLRWTPGFCDLPKRHGKLKV--L 66
gi 19920632   18 AAPQLDLGGghyvprqqhlNDEIAITGFSGRLPESST--IEEFKQNLFDGVDMVNDDPRRWERGLYGLPDRIGKLKDsdL 95
gi 7295849     6 KAQGESAAGe---------DADIVISGLSGKLPESSN--IEEFKYNLLNGIDMVTDEPRRWEAGIYGLPERMAKMKDsdL 74
gi 17507095    1 MDPKRWWEK----------QEDIVIS--KDQIPRCDNkeVKMFGGMLLACDDVVTEDQLSWAPGFTDLPKKRGKKKD--L 66
gi 21618359    1 -------------------MEEVVIAGMSGKLPESEN--LQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKD--L 57
gi 21618359    1 -------------------MEEVVIAGMSGKLPESEN--LQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKD--L 57
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093   67 NKFDAGFFQVTPKQANFMDPQVRLLLEASWEAMVDAGINPTDLRGSKTGVFVGCSASETSGMLTQDPDT-VTGYTLTGCV 145
gi 19920632   96 ENFDQQFFGVHQKQAECMDPLLRMLLELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADR-VNGYGLTGCA 174
gi 7295849    75 EKFDDKFFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPVQLRGSRTGVYIGLSFVETEHEIPNMEPSsINGYCLTGCA 154
gi 17507095   67 NKFDAGILPGTSKQNNPMDPQVRLLLEASWEAMVDAGINPRGLRGSQIGDFDECATPGTSGTQKQNPVT-EMGCIMSDTV 145
gi 21618359   58 SRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEALSRDPET-LVGYSMVGCQ 136
gi 21618359   58 SRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEALSRDPET-LVGYSMVGCQ 136
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  146 RSMFSNRISYTFDLQGPSFSVDTACSSSLLALQLAVDSIRQGQCDAAIVAGAHLTLTPTAALQFLRLGMLTDKGSCRSFD 225
gi 19920632  175 RAMFANRISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKRLNMLSPDGSCKAFD 254
gi 7295849   155 RAMFANRISYTFDFKGPSFIVDTACSSSLVALNHAFADMRAGRCDYALVAGVNLILKPIFALQFLRLGIVSHDGSCKTFD 234
gi 17507095  146 PSMFSNRISYTFDLQGPSHSADKINFSTKKRMTKLRNRNSIV-------------------------------------- 187
gi 21618359  137 RAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFD 216
gi 21618359  137 RAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFD 216
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  226 ESGDGYCRTEGVAAIFIQRKKKAQRLYATVVHAKSNTDGHKEHGITFPSGERQAQLLQEVYSEAGIDPNSVYYVEAHGTG 305
gi 19920632  255 ESGNGYVRSDGCVVLLLQRTSAARRVYASILNVRTNTDGFKEQGITYPIGKMQNRLIRETYEEIGLNPADVVYVEAHGTG 334
gi 7295849   235 AAANGYARADTCAVVLLQRRKEAKRVYASILNVRTNTDGFKEQGVTFPDGRMQQALLEETYSEIGLNPDEVVYVEAHGSG 314
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  217 TAGNGYCRSEGVVAVLLTKKSLARRVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTG 296
gi 21618359  217 TAGNGYCRSEGVVAVLLTKKSLARRVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTG 296
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  306 TKVGDPQEANAICEVFCS-KRTDSLLIGSVKSNMGHAEPASGVCSLTKILLSIERQLIPPNLHYNTPNQYIPGLTDGRLK 384
gi 19920632  335 TKVGDPQEVNSITDFFCK-DRTTPLLIGSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLK 413
gi 7295849   315 TPVGDDQEANMLSNFFCRpSRSTPLLIGSVKSNMGHAEPASGVSALAKMIIAMEEGIIPKNLHYRTPNPSVPALVEGKLK 394
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  297 TKVGDPQELNGITRALCA-TRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFHSPNPEIPALLDGRLQ 375
gi 21618359  297 TKVGDPQELNGITRALCA-TRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFHSPNPEIPALLDGRLQ 375
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  385 VVTEPTALPGGLIGINSFGFGGSNTHVILKAADHIA-PPITPHPF----TKLVTYCG-RTQEAVENIFTEIESNKDDLYL 458
gi 19920632  414 VVDRNLPWNGGIIGLNSFGFGGANAHVILKSNPKPK--ALTPKDG----ALKVVLASgRTFEAVEQLLESASTNADDDEY 487
gi 7295849   395 VVDRNLPWQGGIVGLNSFGFGGANAHVVLKSHTKAKePKACPKAGeaeqSLSLVTCSgRTEDAVNQLLKVATEQRHDQEL 474
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  376 VVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPP-PAPAPHAT----LPRLLRASgRTPEAVQKLLEQGLRHSQDLAF 450
gi 21618359  376 VVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPP-PAPAPHAT----LPRLLRASgRTPEAVQKLLEQGLRHSQDLAF 450
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  459 QALLANQANMPANLLPFRGYMLLDREnnvETLKSITKVPITEaRPIYFIYSGMGSQWPGMAIKLMKIPMFDDSLRASSKT 538
gi 19920632  488 LQLINEIHSKAIPNHFFRGYGVVSSKg--THQREVIESNDDK-RPIWYIYSGMGSQWASMAKDLMKIEAFAKTIQRCADV 564
gi 7295849   475 LTLINDIHSHPIPLHPFRGYAVLGTSg--CVKEEVLPYEEEE-RPIWFVYAGMGSQWARMAKDLMQLEVFRNSIQHCAEV 551
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  451 LSMLNDIAAVPATAMPFRGYAVLGGE---RGGPEVQQVPAGE-RPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEA 526
gi 21618359  451 LSMLNDIAAVPATAMPFRGYAVLGGE---RGGPEVQQVPAGE-RPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEA 526
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  539 LEEFGLDVYGMLCNPDPEQYSNnTMNCMLAITAIQIALTDVLTALGVSPDGIIGHSTGEMGCGYADGGITREQTMRLAYH 618
gi 19920632  565 LKPEGVDLIDVLTRSTDKSFEN-ILNSFISIAAMQVALTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYW 643
gi 7295849   552 LAQVDFDLIDVLTRSTERTFDN-MLYSFVSVSAVQVALTDLLRVLDIRPDGIIGHSAGELGAAYMDGCLTAEQTVLAAYW 630
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  527 VKPFGLKVSQLLLSTDESTFDD-IVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYW 605
gi 21618359  527 VKPFGLKVSQLLLSTDESTFDD-IVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYW 605
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  619 RGTTIMKH-TEIKGAMAAVGLTWEQVKEQAPPGVVAACHNGADSVTISGDAEGVATFCAQLKEKDIFAKVVDTSGIPFHS 697
gi 19920632  644 RGKSILDT-QLAKGKMAAVGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSGYAFHS 722
gi 7295849   631 RGRSVLDTpDLPRGKMAAVGLSWEQIGSQIPKDCYPVCHNSDDNCTVSGPPSSMDAMIEDLTAKGIFVREVGSGGYAFHS 710
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  606 RGQCIKEA-HLPPGAMAAVGLSWEECKQRCPPAVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFHS 684
gi 21618359  606 RGQCIKEA-HLPPGAMAAVGLSWEECKQRCPPAVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFHS 684
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  698 PAMLAVQDEMIECMRTAVPEPKPRSSKWISTSIPEDDWESDLAATCSAEYHVHNACSPVLFYEAIQKIPANAVTIEMAPH 777
gi 19920632  723 KYIAEAGPKLRKSLEKIIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYHVNNLLSPVLFHEALQHVPKNAISVEIAPH 802
gi 7295849   711 PYIEGAAPMLRRSLERLITEPKKKSIRWLSTSVKEAEWDSEKNHLASAGYFINNLISPVLFHQAVKRIPQNALIVEIAPH 790
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  685 YFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPH 764
gi 21618359  685 YFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPH 764
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  778 SLMQAILRRSLQKTVTNVGLMNRPKSENddeLESFLGSLGKIYQAGVNIQITELYPGGQYKgvVPKGTPMIGPMWKWDHT 857
gi 19920632  803 GLLQAILKRALGPDATNLSLVKRGHENN---VEFFLTNVGKLFAAGAQPQVLTLVRPISYP--VGRGTPMLNSKVGWDHT 877
gi 7295849   791 GLFRAILR-SLSPQISYVSLMQRGHANN---FEFLLSQLGRLYAAGGQPQILKISPSIPYP--VSRGTPMLGSLVGWDHT 864
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  765 ALLQAVLKRGLKPSCTIIPLMKKDHRDN---LEFFLAGIRRLHLSGIDANPNALFPPVEFP--APRGTPLISPLIKWDHS 839
gi 21618359  765 ALLQAVLKRGLKPSCTIIPLMKKDHRDN---LEFFLAGIRRLHLSGIDANPNALFPPVEFP--APRGTPLISPLIKWDHS 839
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  858 QDWLTIdgrqVLAGGSGSvaSSATYNIDPFATDskETYLLDHVIDGRVLYPFTGHMVLAWRTLCKLKGLDYTKTPVVFEN 937
gi 19920632  878 QKWLVA----KFGKETSS--GETIVEVDLSKED--DAFLAGHTIDGRILFPATGYMTLAWQTFAKMQGSEFHKTPVVMEN 949
gi 7295849   865 QKWNYP----KFKGGRQA--GQLSVELDLGKEE--NVYLAGHTIDGRVLFPATGYMTLAWMSLAQQQGLDYLRTPVLFED 936
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  840 LAWDVPaa-eDFPNGSGSp-SAAIYNIDTSSESp-DHYLVDHTLDGRVLFPATGYLSIVWKTLARPLGLGVEQLPVVFED 916
gi 21618359  840 LAWDVPaa-eDFPNGSGSp-SAAIYNIDTSSESp-DHYLVDHTLDGRVLFPATGYLSIVWKTLARPLGLGVEQLPVVFED 916
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093  938 INVFSATILTKP--IKLDVVLSPGNGYFEIISDDQVAASGRIYIPEDNQPFYyGKLEDIRTSEIADriELDTEDAYKEFL 1015
gi 19920632  950 LVFHRATILNKNavVKFGINFFDGTGAFEICESGSLAVSGKITIPESIDNEE-LPLEEQTPSAVAK--ELGTNDVYKELR 1026
gi 7295849   937 VVFHRATILSVGtvVKLTLNFFPGSSSFEICEGTSLVTSGKIRLVSNVQQEQ-LQLSSLPGIAGSN--KLSTKDIYKELR 1013
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  917 VVLHQATILPKTgtVSLEVRLLEASRAFEVSENGNLVVSGKVYQWDDPDPRL-FDHPESPTPNPTEplFLAQAEVYKELR 995
gi 21618359  917 VVLHQATILPKTgtVSLEVRLLEASRAFEVSENGNLVVSGKVYQWDDPDPRL-FDHPESPTPNPTEplFLAQAEVYKELR 995
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1016 LRGYEYGQAFRGIYKTCNSGERGFLYWTGNWVTFLDSLLQTALLAERSDTLRLPTRVRHLRIDPNKHLEHVVEKDGIQVI 1095
gi 19920632 1027 LRGYDYGGIFRGIVRSDTVASTGKLQWVDNWISFMDTMLQFSILSKNLRELYLPTRIERAVINPAKHFELLSALTKEEQV 1106
gi 7295849  1014 LRGYDYTGVFQGILESDISAVTGQLQWADNWISFMDTMLQFRILSNDIRELYVPTGIERALIDPLKHLELAKKHQQK--L 1091
gi 17507095      --------------------------------------------------------------------------------
gi 21618359  996 LRGYDYGPHFQGILEASLEGDSGRLLWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQV 1075
gi 21618359  996 LRGYDYGPHFQGILEASLEGDSGRLLWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQV 1075
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1096 E----LRNDHstnGCIAGGVECCDLNAHSVARRIQVSGQLYHEKIFFVPHFDHNCLSGhkktstilkdysavikqqlytg 1171
gi 19920632 1107 EtglpVQWYSdinVIKSAGVELRGLKANLAQRRPGTQAPPTLERYQFVPNINTTDLNE---------------------- 1164
gi 7295849  1092 T----VNWHRnisVVKCGGVEIHKMKTAQTQRRSGGQSPPSLERYRFWPHSQHLGQRE---------------------- 1145
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1076 AdvvvSRWLR---VTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSEra-------------------- 1132
gi 21618359 1076 AdvvvSRWLR---VTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSEra-------------------- 1132
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1172 fskWQSAGLLKKLKNGAQIVKALAVLKASQSDVVLDDTVTrfthdgkctVLHHIADMFKIEDcedfedrvaaklksvrgi 1251
gi 19920632 1165 ---NSEKARLHALDVAIQVIIENSSGAVKLKGVELANGR----------NPDVLVANRLLQI------------------ 1213
gi 7295849  1146 ---EQEKSRSTALAVAIQLIIENSGGAVKLKGVELAGSRS---------TLDALSAVQLLEL------------------ 1195
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1133 -alQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRdps---qqeLPRLLSAACRLQLngnlqlelaqvlaqerpk 1208
gi 21618359 1133 -alQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRdps---qqeLPRLLSAACRLQLngnlqlelaqvlaqerpk 1208
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1252 FELDRLWAGavlndrivkslqDICIENSAGHHATMAAVDLVSTdqirhCIeansshplletdYTCIGanvdhLDESTLEI 1331
gi 19920632 1214 IEGEPVLTG------------DVAVVTSNNNEETITAALGDSG-----VR------------VVSKD-----VLKEPVEQ 1259
gi 7295849  1196 IEREPILVG------------DMAVVTSSSNESELGEQLKEHG-----IR------------VIVKD-----IKAGAVEQ 1241
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1209 LPEDPLLSGlldspa-lkaclDTAVENMPSLKMKVVEVLAGHGhlysrIPgllsphpllqlsYTATDrhpqaLEAAQAEL 1287
gi 21618359 1209 LPEDPLLSGlldspa-lkaclDTAVENMPSLKMKVVEVLAGHGhlysrIPgllsphpllqlsYTATDrhpqaLEAAQAEL 1287
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1332 IGGKKQKidlennftghgevknLDYVLLdkviskkaDPIAFIEACKHLIR-ETGFLLVVEVTSqyeialaiegllGNEMV 1410
gi 19920632 1260 NCHFVFG---------------IDVLSR--------PDTKTLENSIASIR-ENGFLILEETLP------------TYTKT 1303
gi 7295849  1242 QCHFVYS---------------VNMLAQ--------NSVKDLQHCLDSLKsDSGFLLLEEAAS------------RYNII 1286
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1288 QQHDVAQgqwdpadpapsalgsADLLVCncavaalgDPASALSNMVAALR-EGGFLLLHTLLRghpsghvafltsTEPQY 1366
gi 21618359 1288 QQHDVAQgqwdpadpapsalgsADLLVCncavaalgDPASALSNMVAALR-EGGFLLLHTLLRghpsghvafltsTEPQY 1366
                       1450      1460      1470      1480      1490      1500      1510      1520
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1411 GDASRKynqffthEqlldmFkstgFLICNFQSDPALMttTYAVRRVSPIPRdpVFIDVDDVKEFNWIEPLQKVSEERLNE 1490
gi 19920632 1304 GRALLT-------K-----F----GFVAVQEQSLGATrvLVLARKAVDLKTrkSVVVVATEQNFNWVDDLKAALATAATE 1367
gi 7295849  1287 GKEKLN-------K-----L----KLVSVLEQFFGTDrvLVLVRKLSKVQSsqALTLHLTNKQFKWVNELKNSIAKAQAE 1350
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1367 GQGILSqd---awEslfsrVs--vRLVGLKKSFYGST--LFLCRRPTPQDS--PIFLPVDDTSFRWVESLKGILADEDSS 1437
gi 21618359 1367 GQGILSqd---awEslfsrVs--vRLVGLKKSFYGST--LFLCRRPTPQDS--PIFLPVDDTSFRWVESLKGILADEDSS 1437
                       1530      1540      1550      1560      1570      1580      1590      1600
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1491 pdsKTIWLVSNKCRNNGIVGLGLCFVEENLK-INRFRSAFDMSankeirdgPPVWNIGDEETKKIVELDLHANDYMDGQW 1569
gi 19920632 1368 e--QYVYVVCQGEELFGAVGLMTCIKNENGGkLARLVFVQDAK--------AEKFSLTSTLYRQQLEKDLISNVLKNGAW 1437
gi 7295849  1351 e--KNLYLVAQGEPNSGALGLMNCLKREAGGhFLRLYLILDEG--------VPQFSLDDPFYAAQLAKDLVVNVYRNGSW 1420
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1438 ---RPVWLKAINCATSGVVGLVNCLRREPGG-TLRCVLLSNLSst----shVPEVDPGSAELQKVLQGDLVMNVYRDGAW 1509
gi 21618359 1438 ---RPVWLKAINCATSGVVGLVNCLRREPGG-TLRCVLLSNLSst----shVPEVDPGSAELQKVLQGDLVMNVYRDGAW 1509
                       1610      1620      1630      1640      1650      1660      1670      1680
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1570 GSMRHIVVKDEDVHVykDCEHAFINTLTRGDVSSLTWFESPNQyfdSMVKSKATQELCSVYYAPINFRDIMLAYGRLPPD 1649
gi 19920632 1438 GTFRHLKLETQQATL--QVEHAYVNALVKGDLASLKWIEAAQAd--TAATVDKNLETCTVYYAPINFRDVMLTSGKLAAD 1513
gi 7295849  1421 GSYRHLKMESRPPML--PVEQAYVNTLVKGDLSSLRWIESPRS-----SPIQSQLEPCTVYYAPLNFRDVMLASGKLGVD 1493
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1510 GAFRHFLLEEDKPEE--PTAHAFVSTLTRGDLSSIRWVCSSLR---HAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPD 1584
gi 21618359 1510 GAFRHFLLEEDKPEE--PTAHAFVSTLTRGDLSSIRWVCSSLR---HAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPD 1584
                       1690      1700      1710      1720      1730      1740      1750      1760
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1650 AIPGNFADRECLLGMEFSGRLKDGTRLMGILPAQALATTVMVDRDYAWEVPRDWTLAEASTVPVVYTTAYYALVRRGLMK 1729
gi 19920632 1514 ALPGDLAEQDCVLGLEFAGRDTQGRRVMAMVPAKSLATTCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMK 1593
gi 7295849  1494 ALPGDLAYQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMK 1573
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1585 AIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVR 1664
gi 21618359 1585 AIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVR 1664
                       1770      1780      1790      1800      1810      1820      1830      1840
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1730 KGDKILIHGGAGGVGQAAIAIALAAGCEVFTTVGSAEKREFLKNLFPQLQEHHFANSRSADFELHIRQHTKGRGVNIVLN 1809
gi 19920632 1594 KGEKILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLVLN 1673
gi 7295849  1574 EGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLN 1653
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1665 PGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLN 1744
gi 21618359 1665 PGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLN 1744
                       1850      1860      1870      1880      1890      1900      1910      1920
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1810 SLANEMLQASLRCLARHGRFLEIGKVDLSQNSSLGMAKLLDNVSVHGILLDSIMDptvGDLDEWKEIARLLEQGIKSGVV 1889
gi 19920632 1674 SLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVME---GEEEMQNQVVSLVAEGIKTGAV 1750
gi 7295849  1654 SLSEEKLQASIRCLALNGRFLEIGKFDLSNNTPLGMSVFLKNTSFHGILLDSVME---GEEEMQLMVAKLVAEGIKSGAV 1730
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1745 SLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFFN---ESSADWREVWALVQAGIRDGVV 1821
gi 21618359 1745 SLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFFN---ESSADWREVWALVQAGIRDGVV 1821
                       1930      1940      1950      1960      1970      1980      1990      2000
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1890 KPLHSHSFPADKAEEAFRFMSAGKHIGKVIMEIRPDEG-TKVCPPSKISVRAICRTLCHPQHTYLITGGLGGFGLELAQW 1968
gi 19920632 1751 VPLPTSVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAgKKALQPKPRLINAIPRTYMHPEKSYILVGGLGGFGLELTNW 1830
gi 7295849  1731 QPLPTTVFAEQEIEKAFRFMASGKHIGKVVIKVRLEEE-QQAALPRLRQIQAIPRSYMHPEKSYILVGGLGGFGLELANW 1809
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1822 RPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPeAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQW 1901
gi 21618359 1822 RPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPeAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQW 1901
                       2010      2020      2030      2040      2050      2060      2070      2080
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 1969 LINRGARKLVLTSRTGIRTGYQARCVHFWRRTGVSVLVSTLNIAKKSDAVELINQCTAMGPIGGIFHLAMVLRDCLFENQ 2048
gi 19920632 1831 LVTRGARYIVLTSRSGVKTGYQGLMIRRWQERGVKVVIDTSDVTTAAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQ 1910
gi 7295849  1810 LVSRGARFLVLSSRSGVKSGYQALMIRRWHDRGVQVQIDTNDVTTAVGCQRLLEVSNKLALVGGIFNLAAVLRDGLIEDQ 1889
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1902 LIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLLENQ 1981
gi 21618359 1902 LIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLLENQ 1981
                       2090      2100      2110      2120      2130      2140      2150      2160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2049 NVQNFKDAAEAKYYGTINLDYASREHCDknILKWFVVFSSITSGRGNAGQTNYGWSNSCMERMIDQRRADGFPGIAIQWG 2128
gi 19920632 1911 TAKDFKTVADPKVTATKYLDQFSRDICT--ELDYFICFSSVSCGRGNIGQTNYGLANSAMERICEQRQVSGFPGTAIQWG 1988
gi 7295849  1890 SPKNFEKVSAPKLLATIHLDKISREICP--ALEYFVCFSSLSCGRGNMGQTNYGLANSTMERICEQRQEYGYPGTAIQWG 1967
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 1982 TPEFFQDVCKPKYSGTLNLDRVTREACP--ELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRHEGLPGLAVQWG 2059
gi 21618359 1982 TPEFFQDVCKPKYSGTLNLDRVTREACP--ELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRHEGLPGLAVQWG 2059
                       2170      2180      2190      2200      2210      2220      2230      2240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2129 AIGDVGVILENMGDNNTVVGGTLPQRMPSCLSSLDNFLSWNHPIVSSFIKAELGSK--KNVGGGDLMATIAHILGVNDIS 2206
gi 19920632 1989 AIGDTGLVLENLGDNDTVIGGTLPQRMPSCLQTIDLFLQQPHPVVASMVVAEKRKS--DQSAGVSLIATIANILGLRDTK 2066
gi 7295849  1968 AIGDTGLIIEHMGNNETVVGGTLPQRMISCLETLDLFLQQPHPVMASMVVAEKRKT--EQANRLSLIATIANIMGLRDVK 2045
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 2060 AIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAyrDRDSQRDLVEAVAHILGIRDLA 2139
gi 21618359 2060 AIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAyrDRDSQRDLVEAVAHILGIRDLA 2139
                       2250      2260      2270      2280      2290      2300      2310      2320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2207 QLNADANLSDLGLDSLMGVEIKQALERDHDIVLSMKEIRTLTLNKLQQLADQGGTGRTALQVNElemk-kdgeRDAELNT 2285
gi 19920632 2067 NIQDGASLADLGMDSLMSAEIKQTLERNFDIVLSAQEIRQLTFGALKAMDGGADVKPAAAAPAAaagvpeaniTSGGSSR 2146
gi 7295849  2046 SVSDKTTLFDLGMDSLMSTEIKQTLERHFDLVLSAQEIRQLTFSALRQID--AQEPPSASVSSPsasstlsriKEEACVE 2123
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 2140 AVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTP---------KEDGLAQ 2210
gi 21618359 2140 AVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTP---------KEDGLAQ 2210
                       2330      2340      2350      2360      2370      2380      2390      2400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2286 AEmleqqmNQLFKMRVDVNDLDPQDIIVKAnKVEEGPITFFVHSIEGIATPLKKVMNKCEFPAYCFQSTKNVPQTSIEDV 2365
gi 19920632 2147 TAspmgdgTQVVFTTSLIPTEAIVQLDTKApANSKQSPIFFISPIEGFASALEPLAKRLEVPAYGLQYTEAVPSDSLESA 2226
gi 7295849  2124 VQpqs-deTRKVFAKEVLPQEVMVRLRSKApVASEDPAVFFLAPIEGFTIAVEALAASLTCPAYGLQCTEQVPLDSIEAC 2202
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 2211 QQ------TQLNLRSLLVNPEGPTLMRLNS-VQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSL 2283
gi 21618359 2211 QQ------TQLNLRSLLVNPEGPTLMRLNS-VQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSL 2283
                       2410      2420      2430      2440      2450      2460      2470      2480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2366 AKCYIREMKKIQPSGPYRLVGYSYGACIGFEMANMLQESDGRDAve-rLILLDGSHLYMQTYRNVYRMAFGVTgdslvNN 2444
gi 19920632 2227 AKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNEVAN----VIMLDGAPSYVNWYTSSFKQRYTDGt---nAD 2299
gi 7295849  2203 AAYYLRQIQKLQPLGPYHIVGYSYGCLLAHAIAVALEQRRFGVK----VIMLDGAPTMASGYVQEAKKQTDD-------L 2271
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 2284 AAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPthnsLFLFDGSPTYVLAYTQSYRAKLTPG-----CE 2358
gi 21618359 2284 AAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPthnsLFLFDGSPTYVLAYTQSYRAKLTPG-----CE 2358
                       2490      2500      2510      2520      2530      2540      2550      2560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17507093 2445 PLFESEIMCAMTLRFANVDYKKFRFELLQQPGFKARVQKVVDQVMLTGLfKSPETVAFACEAMHSKFLMADKYKPRRNFG 2524
gi 19920632 2300 NDNQSYGLAYFGIVLANIDYKALVRLLIVIPTWEEKLERFAELMSNEIT-QPVETIKKSATLFYKKLELADGYQPTLKLK 2378
gi 7295849  2272 NRQQSMTLAYFGALLADVDYNQLLQLLDGVQTWPSKLDKLADTLAGYTQ-QTREVIKKAACMFKQKLLLSESYKGAKQLH 2350
gi 17507095      --------------------------------------------------------------------------------
gi 21618359 2359 AEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQgLDRQELSFAARSFYYKLRAAEQYTPKAKYH 2438
gi 21618359 2359 AEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQgLDRQELSFAARSFYYKLRAAEQYTPKAKYH 2438
                       2570      2580      2590      2600      2610      2620
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 17507093 2525 GHITLIRAEQGAAReedVGEDYGVAAVS-EDCEVLKVKGDHDTFVqGKSSSVTVEHINRIILQ 2586
gi 19920632 2379 TNVTLVKPTDNSAK---LDEDYRLKEVCtKPVEVHTVEGNHRTFLiEDQSLKTIQSILKRLFN 2438
gi 7295849  2351 SDVVLIKSAEHNAI---MAQDYGLKEICsAQIDMHVVEGTHRTFLkEPHTLQIIERVLRKRP- 2409
gi 17507095      ---------------------------------------------------------------
gi 21618359 2439 GNVMLLRAKTGGAYgedLGADYNLSQVCdGKVSVHVIEGDHRTLL-EGSGLESIISIIHSSLA 2500
gi 21618359 2439 GNVMLLRAKTGGAYgedLGADYNLSQVCdGKVSVHVIEGDHRTLL-EGSGLESIISIIHSSLA 2500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap