Conserved Protein Domain Family
KOG1145

?
KOG1145: KOG1145 
KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 229088
View PSSM: KOG1145
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  318 VDKFASKKKGVDPAASQAVLAPTKPgKgppsnkFrVEHRNKKNASASPRRRIVAEDdgddDASISRSgrkgRKWSKASRK 397
gi 28381483    1 --------mlriinisrlgntlhfsravtqwqlplafqrefhvsaarlkrrktaeekkspriieyspkkfqtagggasdi 72
gi 15237076      --------------------------------------------------------------------------------
gi 17561042    7 LQLLRTATSRQLLRCSQVQTTTT---F------WrIQTQQFASEGKRGRRKFVEAA----VVKSTKS------TKQTVDV 67
gi 1170499    18 YRQLHSLCQRRALRQWRHGFSSAYPvWtaqlcaWpWPTDVLNGAALSQYRLLVTKK----EEGPWKSqlssTKSKKVVEV 93
gi 6016315     1 MAFLSACTSWRHVHNAGFTFITKFPfVr-----N-VHKLSYHISPLSSRFSLADISv---KENNHPNgpqlRLQTHFFHS 71
gi 2506776     1 MLRRHGLFWLKTCPRLNVLLNQSIP----------IPHLLHSRDICQQRWYAKGKR----RNQISKK----ELKPLNFSI 62
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  398 AVRLQAAKDAAPVKAEILEVEEEGMSIEDlAYNLAIGEgdilGYLYSKGIRpdgvhtldrEMVKMICRDYDVEVLDADSV 477
gi 28381483   73 wrhMTVAQLAKELERSLDDVQEAMLYVKG-ADNIEPAF----KLADLKIIQ---------EIAKKLGAKTRVVATPEETN 138
gi 15237076    1 ---MTLLELSKRTGESVAVLQSILINVGE----TFS------SEFDTISV----------DVAELLAMEIG--------- 48
gi 17561042   68 WKQMNPSELAAALSVDLSEITEFLESLDRrNVDAIISD----SPLDDVSIL---------QTTAAFSFKPRFVNGPPKK- 133
gi 1170499    94 WIGMTIEELARAMEKNTDYVYEALLNTDI-DIDSLEAD----SHLDEVWIK---------EVITKAGMKLKWSKLKQDK- 158
gi 6016315    72 SSPMHATKGFRFPKSSTPLTLPAVLSVASfANLLQIPTrrilRDLNRLGIK---------DVFPEYLITYEYSSLLAEEY 142
gi 2506776    63 PNYISVNKLANLLNCRVERLIKDLTALGF-------------ENITTTYILs-------kEYVELILQEYNFALPNLSTS 122
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  478 k--VEEMAKKRQTFDEEDLDKLED---RPPVITIMGHVDHGKTTLLDYIRKSKVAASEAGGITQGIGAYKVSVPvDGklQ 552
gi 28381483  139 a--DEQKERDVAPRPPAAPELLQP---RPPVVTVMGHVDHGKTTLLDSLRGADVAAGEAGGITQHIGAFTVTLE-NG--E 210
gi 15237076   49 --------INVRRQHSTEGSEILP---RPPVVTVMGHVDHGKTSLLDALRNTSVAAREAGGITQHVGAFVVGMPdSG--T 115
gi 17561042  134 ---TEKEDADLHPQLEASPKDLER---RPPIVTIMGHVDHGKTTLLDAMRNSQIAAGEFGGITQHIGAFSVELT-KG--R 204
gi 1170499   159 ----VRKNKDAVRRPQADPALLTP---RSPVVTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLP-SG--E 228
gi 6016315   143 gfdVQEAAAYSAPSPKSLNSKKDSgplRPPVVTLMGHVDHGKTTLLDAFRKSTIASTEHGGITQKIGAFTVPFD-KGs-K 220
gi 2506776   123 ---TNLDNVYDELKSPVNPKLLTK---RAPVVTIMGHVDHGKTTIIDYLRKSSVVAQEHGGITQHIGAFQITAPkSG--K 194
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  553 SCVFLDTPGHEAFGAMRARGARVTDIAIIVVAADDGIRPQTNEAIAHAKAAAVPIVIAINKID---KE---GASPDRVMQ 626
gi 28381483  211 RVTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDGVMAQTREVIQLAKEAQVPIIVALNKID---KP---EANIEKSKR 284
gi 15237076  116 SITFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDGVMPQTLEAIAHARSANVPVVVAINKCD---KP---GANPEKVKY 189
gi 17561042  205 RVTFLDTPGHAAFASMRARGAKGADIVVLVVAADDGVKEQTAQSIKFAKDANVQLVVAVNKID---KP---NADPMRAMR 278
gi 1170499   229 KITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCD---KA---EADPEKVKK 302
gi 6016315   221 FITFLDTPGHMAFEAMRKRGANIADIVVLVVAGDDGVKPQTVEAIKHIQSADVPVVVALTKSD---RP---GTPIHKIYE 294
gi 2506776   195 KITFLDTPGHAAFLKMRERGANITDIIVLVVSVEDSLMPQTLEAIKHAKNSGNEMIIAITKIDripQPkerEKKIEKVIN 274
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  627 ELSSIGLMPEDWGGDVPM-------------VQISALKGENVDDLLETVMLVAELQELKAN--PHRNAKGIVIEAGLDKA 691
gi 28381483  285 ELAQMGLALEEHGGDVQV-------------IPISALKGTNLELLAEAVSTQATLMGLKAD--PTGLVEGIVVESKTDPR 349
gi 15237076  190 QLTSEGIELEDIGGNVQVkdnpgwfgliwflLQFGLAKSTGLDKLEEALLLQAVDMDLKAR--VDGPAQAYVVEARLDKG 267
gi 17561042  279 SLLEHDVVVEQLGGDVQC-------------VEVSALQSRNLPSLQDALLLQADVMDLKAT--KKGKVEAVIIESSVVHG 343
gi 1170499   303 ELLAYDVVCEDYGGDVQA-------------VPVSALTGDNLMALAEATVALAEMLELKAD--PNGPVEGTVIESFTDKG 367
gi 6016315   295 QLLNNGIQVEALGGETQI-------------IPISAKTGKGIPELEAAILTLAEIMEIRAS--PRDPFQGWIVESSVTKG 359
gi 2506776   275 DLIVQGIPVEKIGGDVQV-------------IPISAKTGENMDLLEESIVLLSEVMDIRAEnsPKTIAEGWIIESQVKKQ 341
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  692 KGPFATFIVQKGTLKRGDVVVCGEAFGKVRALFDHSGERVDEAGPSIPVQVIGLN-NVPIAGDEFEIVSSLDVAREMAEA 770
gi 28381483  350 RGKLSTAIVSRGTLRKGSVLLSGLAHAKVRGLFDHNGQPLSEAPPGTPVEILGWR-ELPLAGDLILEVETEKKAHAVLKY 428
gi 15237076  268 RGPLATIIVKAGTLVRGQHVVIGCQWGRLRAIRDMIGKTTDRATPAMPVEIEGLK-GLPMAGDDVIVVESEERARMLSEG 346
gi 17561042  344 IGKVCTLVVSRGTLKKGCVLVAGSSWCRVKTMHDENGKIVQVATPSQPVRVSGWKdDLPTPGDLVLEAETVDRAQKAVNL 423
gi 1170499   368 RGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITGWR-DLPSAGEEILEVESEPRAREVVDW 446
gi 6016315   360 VGSSATVVVKRGTVKKGMYLVAGKSWCKVRSLVDVNKKSIKQVLPGQAAQVYGWK-DLPIAGDLAYEVKSESEAKRILSD 438
gi 2506776   342 VGNVATVLVKKGTLQKGKILICGNTFCKIKNLIDDKGIPILKATPSYATEVLGWK-DVPHVGDEVIQVKSEAIAKKFISK 420
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  771 RAVSLRDERISAKAGDGKVTLSSLASAVSAKKMSG--------------------LDLHQ----------LNIILKVDVQ 820
gi 28381483  429 REHESQQEKIESSSDEIRKKEEEHQAKYRAEREARrlagrfrm----rggqrvkqVDENegk------prVSVIIKGDVH 498
gi 15237076  347 RKRK--YEK-DRLLKAEEARLEEAAARLETESEEGfv-----------------rVELP-------------IVVKSDVQ 393
gi 17561042  424 RIDNMMREKADRDWEDTKDQRDKARETYLSNRQQLldrgqrfgstlrnivhkkqrIEKDVadg----spkFRLIIRTDVE 499
gi 1170499   447 RKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYghllwkkrsi-lrflerkeqIPLKPkekrerdsnvLSVIIKGDVD 525
gi 6016315   439 IYRQS-NEQ--NFYELAESQNEQRVSALAAKKSGPaaiq------------eetsVSKS-----------FNIIAKCEDT 492
gi 2506776   421 RQDLIEVQKNSSIVEKLNEERALAKEQHLNKELEHen-----------------tVQEHEqntg---pklINYIIKCDVS 480
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  821 GSIEAVRQALQVLP-QENVTLKFLLQATGDVSNSDVDLASASEAIVFGFNVKASGSVKKAAENKGVEIRLYRVIYELIDD 899
gi 28381483  499 GSVEAILDVLETYNsNESCRLDIVHYGVGNVTEGDLELAKAFHAIIYAFAVETP----QLKAAKEVNIRSYNIIYRLIDD 574
gi 15237076  394 GTAQAVADALRTLN-SPQVSVNIVHSGVGAISHSDLDLAQACGACIVGFNVKGGSTGNLSAAQGSVKVFHHRVIYHLLED 472
gi 17561042  500 GTLEAILEILSTYK-SEQCKLQLVDFEVGPPTEKDIELAKETDATIYTFNVETSAKLKQRADAAGIQIDSFNVIYRMIES 578
gi 1170499   526 GSVEAILNIIDTYDaSHECELELVHFGVGDISANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVED 605
gi 6016315   493 GSMEALSDYLKPLQ-FGKVKSRVLYTGVGPVTETDIERAETSDAIIISFGVSVPKATFRLAEKHNVKLLFHNVIYHLMDD 571
gi 2506776   481 GSAEAVSESISSLG-NDEVRCNVISSSVGIPTESDLKMAQITESTILCFNLGNLPS-EVINNRAGIKIKQYNVIYKLIED 558
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15220055  900 VRNAMEGLLESVEEQIPIGSAEVRATFSSGS---GR-----VAGCMVNEGKFVKDCGIRVVR--KGKTVHVGVLDSLKRV 969
gi 28381483  575 LKEQLSSKLPPVEVEEVLGEANVLQNFLINEg-rKEv---pVAGCRCTKGVLKKAQKFRLLR--DGEVVYDGPLESMRHL 648
gi 15237076  473 IGNLIVEKAPGVSEMEVSGEAEVLSIFKILGkrrTEedgvnIAGCKVMDGRVCRSGLMRLLR--SGEVVFEGSCASLKRE 550
gi 17561042  579 LKGELSARIPKLTELHLVGEGHVLKEFVISDrgrKRq---pIAGTLVNWGNFDRHCIYKFTR--GNQVVYEGEVETMKAG 653
gi 1170499   606 LQEELSSRLPCAVEEHPVGEASILATFSVTEg-kKKv---pVAGCRVQKGQLEKQKKFKLTR--NGHVIWKGSLTSLKHH 679
gi 6016315   572 VRKLFALRLPPILVQRVTGEAIISAIFDIKA---KRav-vhVAGCRVTNGTIEKSHKIRLVR--NDKIIWSGEIDSLKHL 645
gi 2506776   559 VTETLTENLKPIFEKKIVSTVDVRETFDFRLk--KKii--rIAGCKVNNGVIKKNSLVQVVRgpNEDVIFDGKISTLKHN 634
                        730       740       750       760       770
                 ....*....|....*....|....*....|....*....|....*....|....
gi 15220055  970 KENVKEVSAGLECGIGMDDYD-DWIEGDIIEAFNav--qKRRTLEEASASMSAA 1020
gi 28381483  649 KNEVDTIKKDVECGLRFRDTKvLPQAGDILQCYT-----TKMEAQQTDWDP-GF 696
gi 15237076  551 KQDVEQVGKGNECGLVFGDWN-DFRVGDVIQCMEpvirkPKFISSESGAVRIEC 603
gi 17561042  654 MEVVTNAKTNTEVGLALSDKNiRFKEDDQVEAYE-----KRTITQEVDWYPPGF 702
gi 1170499   680 KDDISIVKTGMDCGLSLDEDNmEFQVGDRIVCYE-----EKQIQAKTSWDP-GF 727
gi 6016315   646 KEEVTSIKKGRECGILLKNFD-EIVTGDKLQTFV----------EE--YKPPDF 686
gi 2506776   635 KDDVAEVSKGHECGITFESGFeGFKPGDKILVYEn---------VR---VPRYL 676
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap