Conserved Protein Domain Family
KOG1144

?
KOG1144: KOG1144 
KOG1144, Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 229087
View PSSM: KOG1144
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  100 FVGK-KKSKGKKG--GGSVSFALLDdedekednesdgdkddepvisftgkkhaskkgkkggnsfaasafDALGSDDDDTE 176
gi 15218159   54 FSARkKKLKSKK---GGSVSFALLD--------------------------------------------------VEDDK 80
gi 25406462   91 FVGKkKKSKGKNR--GGSVSFALLSgkeetddnesngdkddepvis---ftgkknasnkgkkgfavsafDALGG-DKDDE 164
gi 25406471   94 FVGNnKKSKGKKD--GGSVSFALLAd------------------------------------------------eDNREE 123
gi 15226229      --------------------------------------------------------------------------------
gi 17556188    3 PKKGgKKNKDDDW--DDDAAEKKLA--------------------------------------------ALSVASNADAQ 36
gi 19173127      --------------------------------------------------------------------------------
gi 1723436     1 MGKKgKKSGYADW--EDDLGEDISGq------------------------------------------nEYLDNTSQDSP 36
gi 1723187     1 MAKKsKKNQQNYW--DEEFEEDAAq-------------------------------------------nEEISATPTPNP 35
gi 14195666    3 KKQKnKSEDSTKDdiDLDALAAEIEgagaakeq-----------------------------epqkskgKKKKEKKKQDF 53
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  177 EVHEDEEEESPITFSGKKKKssksskkntnsftadlldeeegtdasnsrddentiedeespevtfsgkkksskKKGGSVL 256
gi 15218159   81 EEAED--------------------------------------------------------------------------- 85
gi 25406462  165 EVDGDEEQVSPITFSGKKTRssksskkttnkvalpdee------------------egtmgdeesleitfsgkKKGSIVL 226
gi 25406471  124 AEDND------ITFSGRKks---------------------------------------------------skKKSSSVL 146
gi 15226229      --------------------------------------------------------------------------------
gi 17556188   37 WDDEEPKKAKTKAKAPAKKG-----------------------------------------------------FAALLDE 63
gi 19173127      --------------------------------------------------------------------------------
gi 1723436    37 QNDELAEKSENLAVSSEKTTskkk----------------------------------------------kgkKNKGNKN 70
gi 1723187    36 ESSAGADDTSREASAS---------------------------------------------------------------- 51
gi 14195666   54 DEDDILKELEELSLEAQGIKadretvavkpten---------------------------neeeftskdkkkkGQKGKKQ 106
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  257 ASVGDDS---VADETKTSDTKNVEVV-ETGKSKKKKK-NNKSGRTVQEEEDLDKLLAALGETPa------aErPASs--- 322
gi 15218159   86 ---GDD---------KNPSIRSDEVVgETSMSKKKKKdKSGKHGVCEEDDDADKILAQHGIT---------T-TVStg-- 141
gi 25406462  227 ASLGDDSvadETSQAKTPDTKSVEVI-ETGKIKKKKKnKNKVARTLEEEDDLDKLLAELGETPa------aErPASst-- 297
gi 25406471  147 ASIGDE----ESSQSKTSDSKSVELV-ESARSKKHKK-KNKSGRTLQEDDDLDKLLAELGETPa------aGkPAS---- 210
gi 15226229      --------------------------------------------------------------------------------
gi 17556188   64 SEPEENYsepPEPEPEVKKAAKVPEKpEKEKKEKKKAgKKGKKGEADEEEDLDALLASFQEKD----------------- 126
gi 19173127      --------------------------------------------------------------------------------
gi 1723436    71 QVSDDESqelESPQGPKELTAVTELDdDEFDYKPKKGkKGKKSKKVEEDDEPQEIESPQGPKEltavteldDdEFDyk-- 148
gi 1723187    52 ------AegaEAIEG-------------DFMSTLKQSkKKQEKKVIEEKKDGKPILKSKKEKE----------------- 95
gi 14195666  107 SFDDNDSeelEDKDSKSKKTAKPKVEmYSGSDDDDDFnKLPKKAKGKAQKSNKKWDGSEEDEDnskkikerSrINSsges 186
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  323 -----tPVEEKAAQPEPVAPVENAGEKEg-------EEETAAAKKKKKKKEKEKEKKAAAAAAATSSVEV-------KEE 383
gi 15218159  142 -----pEAEIALAQPEQVASADGAVDKDge----ekTVESATAKKKKKKKDKDKKAS---ASLAISSVEA-------KED 202
gi 25406462  298 -----pEVEKVQAQPGPVAPVENAGEKEge----keTVETAAAKKKKKKKEKDKEKK--AAAAATSSVEA-------KEE 359
gi 25406471  211 ------EEEKDQAQPEPVAPVENTGEEE--------TVETAAAKKKKKKKEKEKEKKAAAAAAATSSVEA-------KEE 269
gi 15226229      --------------------------------------------------------------------------------
gi 17556188  127 ------GPKVAEVAPEAVAAPEAAPVDD--------KKSKKKKEKPVEKPEEPAVEEDSDGEGDEKDQDK-------KDK 185
gi 19173127      --------------------------------------------------------------------------------
gi 1723436   149 -----pKKGKKGKKAQNNNESEAAAPPEipevrvktKKEKEREKKEREKLRKKQQQAKKKGSTGEDTLAS-------SEV 216
gi 1723187    96 -------KEKKEKEKQKKKE-QAAR-----------KKAQQQAQKEKNKELNKQNVEK---------AAA-------EKA 140
gi 14195666  187 gdesdeFLQSRKGQKKNQKNKPGPNIESgnedddasFKIKTVAQKKAEKKERERKKRDEEKAKLRKLKEKeeletgkKDQ 266
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  384 KQEESVT------------------EPLQPK----------KKDAKGKAAEKKIPKH-----------------VREMQE 418
gi 15218159  203 RQG--------------------------------------KKDVKIKVAEKKVPKH-----------------VREKQE 227
gi 25406462  360 KQEESVT------------------EPLQPK----------KKDAKGKAAEKKIPKH-----------------VREMQE 394
gi 25406471  270 KQEESVT------------------EPLQPR----------KKDAKGKAAEKKIPKH-----------------VREIQE 304
gi 15226229      --------------------------------------------------------------------------------
gi 17556188  186 KKQKKKD------------------KKKEKE----------KKEKEDKKGGAGAKKGn----------------LSLIKE 221
gi 19173127      --------------------------------------------------------------------------------
gi 1723436   217 SSEVDIS------------------TPAEND----------S-SAKGKQAAGSKRKGp---------------nVTALQK 252
gi 1723187   141 AAEKSQK------------------SKGESD----------KPSASAKKPAKKVPAG-----------------LAALRR 175
gi 14195666  267 SKQKESQrkfeeetvkskvtvdtgvIPASEEkaetptaaedDNEGDKKKKDKKKKKGekeekekekkkgpskatVKAMQE 346
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  419 ALARRQEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAKRKRKEKEKEKLLRKKLEGKLLTAKQKTEAQKREAFKNQL 498
gi 15218159  228 TLARWKEAEDGKKKEEEERLRKEEEERRIEEEREREAEEIRQKRKIRKME----KKQEGLILTAKQKRDAAKNEAFRKRV 303
gi 25406462  395 ALARRQEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAKRKRKEKEKEKLLRKKLEGKLLTAKQKTEAQKREAFKNQL 474
gi 25406471  305 ALARRQEAKERKKKEEEEKLRKEEEERRRQEELDAQAEEAKRKRKEKEKEKLLRKKLEGKLLTAKQKSEAQKREAFKNQL 384
gi 15226229      --------------------------------------------------------------------------------
gi 17556188  222 MLKKQQEEREEQERLQKEQQERDAQEEKERLEREHAEKERKEAAKEAKRLEVERQKAAGTYQTAAQKRQQALALEKLRAA 301
gi 19173127      --------------------------------------------------------------------------------
gi 1723436   253 MLEEKRAREEEEQRIREEEARIAEEEKRLAEVEEARKEEARLKKKEKERKKKEEMKAQGKYLSKKQKEQQALAQRRLQQM 332
gi 1723187   176 QLELKKQLEEQEKLEREEEERLEKEEEERLANEEKMKEEAKAAKKEKEKAKREKRKAEGKLLTRKQKEEKKLLERRRAAL 255
gi 14195666  347 ALAKLKEEEERQKREEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAEATLKLL 426
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  499 LAAG--GGLPVADNDGDatSSKRPIYANKKKS-SRQKGID-TSVQGEDEVEPKENQAdeq-dtlGEVGLTDTGKVDLIEL 573
gi 15218159  304 LTDA--GSLLVADKNGD--SSKRPIYGNKNKL-ACKKANDpASVQAKGDGETKENHAadepctlPDLVSVEDRRVGIIES 378
gi 25406462  475 LAAG--RGLPVADDVGDatSSKRPIYANKKKP-SRQKGND-TSVQVEDEVEPQENHAat----lGEVGSEDTEKVDLLES 546
gi 25406471  385 LAAG--GGLPVADDDDDatSSKRPIYANKKKS-SRQKGND-TSVQVEGEVEPKENHAl------GEVGSADTEKVDLLES 454
gi 15226229      --------------------------------------------------------------------------------
gi 17556188  302 GHSV--PAPRDSTEDEAagVKKSFVYVDEKTK-AKQEEKKrRRLEKLGQLPVAAEAS-------ADASASASAEASAETP 371
gi 19173127      --------------------------------------------------------------------------------
gi 1723436   333 LESGv-RVAGLS--NGE--KKQKPVYTNKKKS-NRSGTSSiSSSGILESSPATSISV-------------DEPQKDSKDD 393
gi 1723187   256 LSSGnvKVAGLAKKDGEenKPKKVVYSKKKK---RTTQENaSEAIKSDSKKDSEVVP-------------DDELKES-ED 318
gi 14195666  427 QAQG----VEVPSKDSL--PKKRPIYEDKKRKkIPQQLESkEVSESMELCAAVEVMEqgvpekeETPPPVEPEEEEDTED 500
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  574 VNTDENSG-PADVAQENGVEEDDeedeWDAKswgtVDLNLKGDFDDEEEEAQPVVKKELKDAISKAHDSGKP-------- 644
gi 15218159  379 VDTEETHE-SVDVSQENGDEEDv----WDAK----TNFTIKGDSDDEEEKPQPVFKKGLKDTASKAHDSDRPtvkpggsg 449
gi 25406462  547 ANTGEKSG-PADVAQENGVEEDDe---WDAKswdnVDLKI----DDKEEEAQPVVKKELK-AHDSDHETEKPtakpagms 617
gi 25406471  455 ANLGEKSGgPADVAQENGVEEDDe---WDAKswdnVDLKIRGDFDDKEEEAQHVVKKEFK-AHYSDHETEKPtakpagms 530
gi 15226229    1 ------------------------------------------------------------------MDLKKP-------- 6
gi 17556188  372 STTPEQEKtPEPVDDWEMAHSEDeasaQKEKpkkpATKASDADEDDDEESSDEESDEESEDSEESEESSSDDd------- 444
gi 19173127    1 ----------------MGKKNRR--------------------DDDYLNTLLGSADKGNKERRKDPEDSEEI-------- 36
gi 1723436   394 SEKVEKETeVERKEENEAEAEAV--------------------FDDWEAALEEPEVAENNEVVTEKKETDIK-------- 445
gi 1723187   319 VLIDDWENlALGDDDEEGTNEET--------------------QESTASHENEDQNQGEEEEEGEEEEEEEE-------- 370
gi 14195666  501 AGLDDWEAmASDEETEKVEGNTVhievKENPeeeeEEEEEEEEDEESEEEEEEEGESEGSEGDEEDEKVSDEkdsg---k 577
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  645 --LIAAVKATP-----EVED-ATRTKRAtrakdaskKGKGLAPSESIE-GEENLRSPICCIMGHVDTGKTKLLDCIRGT- 714
gi 15218159  450 kpKTAAKKAMP-----KVDD-TTRPKDTs------kKDEGLVLNELAKeVEENLRSPICCIMGHVDSGKTKLLDCIRGT- 516
gi 25406462  618 klTTGAVKAIS-----EVEDaATQTKRAk-------KGKCLAPSEFIKeGGENLRSIICCIMGHVDSGKTKLLDCIRGT- 684
gi 25406471  531 klETAAVKAIS-----EVEDaATQTKRAk-------KGKCLAPNEFIEeGGEKLRSIICCIMGHVDSGKTKLLDCIRGT- 597
gi 15226229    7 ---SARGGDD------KQQIvGDEHSRR---------------NKLSE--EDKVRSPICCMMGHIDTGKTKLLDYITG-- 58
gi 17556188  445 --EDRGGQQKE-----TVEErMERIKLR---------IAKRKEVAQANrSTDNLRSPVICVLGHVDTGKTKISAEQKSEk 508
gi 19173127   37 --GKSVSKMSV-----GEAQkSSK---H--------NERETGTRLNNReKPSEFKSPICCILGHVDTGKTKLLDKLRES- 97
gi 1723436   446 --SDAVEHSIK-----DKEDsKTDKVDD--------IPQAAPAESNVSeS--DLRSPICCILGHVDTGKTKLLDNLRRS- 507
gi 1723187   371 --ERAHVHEVA-----KSTPaAT--------------PAATPTPSSASpNKKDLRSPICCILGHVDTGKTKLLDKIRQT- 428
gi 14195666  578 tlDKKPSKEMSsdseyDSDDdRTKEERAydk--akrRIEKRRLEHSKNvNTEKLRAPIICVLGHVDTGKTKILDKLRHT- 654
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  715 ----------------------------------------------------NVQEGEAGGITQQIGATYFPAENIRERT 742
gi 15218159  517 ----------------------------------------------------NVQEGEAGGITQQIGATFFPAENIRERT 544
gi 25406462  685 ----------------------------------------------------NVQEGEAGGITQQIGATYFPAKNIRERT 712
gi 25406471  598 ----------------------------------------------------NVQEGEAGGITQQIGATYFPAKNIRERT 625
gi 15226229   59 ----------------------------------------------------NVQEGEAGGTTQKMGATYLSARNILEKT 86
gi 17556188  509 kkgfygfsseiyykisiftkkspkkpyfslkiiifcakfsgkiefsanfrreNVIFSNYSTKKNVIESNFREKCNLQQYF 588
gi 19173127   98 ----------------------------------------------------NVQEEEAGGITQQIGATFFPVS------ 119
gi 1723436   508 ----------------------------------------------------NVQEGEAGGITQQIGATYFPIESIKQKT 535
gi 1723187   429 ----------------------------------------------------NVQGGEAGGITQQIGATYFPIDAIKAKT 456
gi 14195666  655 ----------------------------------------------------HVQDGEAGGITQQIGATNVPLEAINEQT 682
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  743 KELKADAK---------------------LKVPGLLVIDTPG-------HESFTNLRSRGSSLCDLAILVVDIMHG---- 790
gi 15218159  545 KELQANAK---------------------LKVPGILVIDTPG-------HESFTNLRSRGSNLCDLAILVVDIMRG---- 592
gi 25406462  713 RELKADAK---------------------LKVPGLLVIDTPG-------HESFTNLRSRGSSLCDLAILVVDIKHG---- 760
gi 25406471  626 RELKADAK---------------------LKVPGLLVIDTPG-------HESFTNLRSRGSSLCDLAILVVDITHG---- 673
gi 15226229   87 MELKSDTK---------------------LKVPRPLFIDTPG-------YEFYTNLRSRGLGLCDFAILVVDIMHG---- 134
gi 17556188  589 DEKTKNHKkhlifiktrdleqnqifnkkrFKKPIFHRIFKEKkidfsfkNEKFTKKKRFFAENCNFIIRRTNVQQGeagg 668
gi 19173127  120 ELFRKCGKr-------------------eSKLPGILVIDTPG-------HESFANLRTRGSSLCNLAILVVDIVHG---- 169
gi 1723436   536 KVVNKKGKl-------------------qYNIPGLLIIDTPG-------HESFTNLRSRGTSLCNIAILVIDIMHG---- 585
gi 1723187   457 KVMAEYEKq-------------------tFDVPGLLVIDTPG-------HESFSNLRSRGSSLCNIAILVIDIMHG---- 506
gi 14195666  683 KMIKNFDRe-------------------nVRIPGMLIIDTPG-------HESFSNLRNRGSSLCDIAILVVDIMHG---- 732
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  791 -------------------------------------LEPQTIESLNLLRMRNTEFIVALNKVDRLYGWKTCKNAPIVKA 833
gi 15218159  593 -------------------------------------LEPQTIESLNLLRRRNVKFIIALNKVDRLYGWEKSKNAPIRKT 635
gi 25406462  761 -------------------------------------LEPQTIESLNLLRMRNTEFIIALNKVDRLYGWKTCKNAPIVKA 803
gi 25406471  674 -------------------------------------LQPQTIESLNLLRMRNTEFIIALNKVDRLYGWKTCKNAPIVKA 716
gi 15226229  135 -------------------------------------LEPQTIECLNLLRMKNTEFIIALNKVDRLYGWRICENAPILEA 177
gi 17556188  669 itqqigatevpaeaikercrqvrgflqdqmkipgfliIDTPGHESFSNLRTRKTPFVIALNKIDRLYEYESNPRKDVYEL 748
gi 19173127  170 -------------------------------------IEAQTLESIELLRKRRTPFVVALNKIDRLYGWKSTPFGGIKEI 212
gi 1723436   586 -------------------------------------LEPQTIESIRLLRDQKTPFVVALNKVDRLYGWHSIKDNAIQDS 628
gi 1723187   507 -------------------------------------LEQQTIESIKLLRDRKAPFVVALNKIDRLYDWKAIPNNSFRDS 549
gi 14195666  733 -------------------------------------LEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAAT 775
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  834 MKQQNKDVINEFNLRLKNIINEFQEQGLNTELY-YKNKDMGDTFSIVPTSAISGEGVPDLLLWLVQWAQKTMVEKLT-YV 911
gi 15218159  636 MMQQTGDVVKEFKMRLNRVQNQFQEQGLNSMLY-YKNREMGETISILPASAISGEGIPDLLLFLVQWAQKTMVEKLT-YV 713
gi 25406462  804 MKQQNKDVTNEFNIRLTDIITQFKEQGLNTEIY-YKNKEMGETFSIVPTSAKSGEGVPDLLLWLVQWAQKTMVEKLT-YV 881
gi 25406471  717 MKQQNKDVINEFNLRLKKIINEFQEQGLNTELY-YKNKDMGETFSIVPTSAISGEGVPDLLLWLVQWAQKTMVEKLT-YV 794
gi 15226229  178 MKQQTKDVINEFNMRLNEIINQFKEQGLNSELY-YKNKEMGETFSIVPTCAISGEGIPDLLLLLVQLTQKTMVEKLItYV 256
gi 17556188  749 LKSQKPRVQAEFKERFNQIVVEFAEQELNVTLSnHKNAEDSDYVCMVPTSAFLGDGIGNLMAFIINQTQTKYAQKLA-FS 827
gi 19173127  213 LKKQSKATINDFKKRLDNTVVAFAEMGLNAKLF-YENTDQKRFVSLVPTSAISGEGIPDLISLILELSEKYMGSKMK-IK 290
gi 1723436   629 LSKQKKAIQREFRDRVESIILQLNEQGLNAALY-FENKNLGRYVSLVPTSAQSGEGVPDLVALLISLTQTRMSDRIK-YI 706
gi 1723187   550 FAKQSRAVQEEFQSRYSKIQLELAEQGLNSELY-FQNKNMSKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLM-YL 627
gi 14195666  776 LKKQKKNTKDEFEERAKAIIVEFAQQGLNAALF-YENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTMLSKRLA-HC 853
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  912 DEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHYKEIKAAQGIKI 991
gi 15218159  714 DKVQCTVLEVKVIEGHGITVDVVLVNGVLREGDQIVVCGSQGPIVTTIRSLLTPYPMNEMRVTGTYMPHREVKAAQGIKI 793
gi 25406462  882 DEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKEIKAAQGIKI 961
gi 25406471  795 DEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKEIKAAQGIKI 874
gi 15226229  257 DKVQCTVLEVKVMEGYGTTIDVVLVNGELHEGGQIVVCGLQGPIVTTIRALLTPHPIKELHVNGNHVHHEVIKAAECINI 336
gi 17556188  828 EELDATVMEVKAIPGLGTTIDVILVNGTMRAGDVIVLTGSDGAITTQVRELLMPKPLKELRVKNEYIHYKEVKGARGVKV 907
gi 19173127  291 NEVECTILEVKNAEGFGVTIDAILSNGMLKEGDRIGVCGFNGPIVTTIKALLMPQPLKELRVKSQYIMVKEVRASLGIKI 370
gi 1723436   707 TTLECTVLEVKVIEGLGATIDVILSNGVLHEGDRIVLCGMGGPIITTVRALLTPQPLKEMRVKSAYVHHKEIKAAMGVKI 786
gi 1723187   628 SHVEATILEVKVVEGFGTTIDVILSNGYLREGDRIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYVHHKEVKAALGVKI 707
gi 14195666  854 EELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKI 933
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470  992 TAQGLEHAIAGTALHVVGPDDDIEAIKESAMEDMESVLSRIDKSGEGVYVQASTLGSLEALLEYLKSpaVKIPVSGIGIG 1071
gi 15218159  794 AAQGLEHAIAGTALHVIGPNEDMEEAKKNAMEDIESVMNRIDKSGEGVYVQASTLGSLEALLEFLKSsdVKIPVSGIGIG 873
gi 25406462  962 TAQGLEHAIAGTSLHVVGPDDDIEAMKESAMEDMESVLSRIDKSGEGVYVQTSTLGSLEALLEFLKTpaVNIPVS---EG 1038
gi 25406471  875 TAQGLEHAIAGTSLHVVGPDDDIEAMKESAMEDMESVLSRIDKSGEGVYVQTSTLGSLEALLEFLKTpaVNIPVSGIGIG 954
gi 15226229  337 IAKDLEHVIVGTALHVVGPDDDIEAIKELVMEDVNSVLSRIDKSGEGVYIQASTLGSLEALLEFLKSpaVKLPVGGIGIG 416
gi 17556188  908 LAKNLEKVLAGLPIYITDREDEVDYLRHEADRQLANALHAIRKKPEG----N-------------------IPYSNVNIG 964
gi 19173127  371 AAGGLEKAIAGSRVLIV--EDNEEEVKRALETDLESVFSSIELSQEGVHVVSSTLGSLEALISFLKT--SKIPILGASIG 446
gi 1723436   787 CANDLEKAVAGSRLLVVGPDDDEEDLAEEIMEDLENLLGRIDTSGIGVSVQASTLGSLEALLEFLKQ--MKIPVASVNIG 864
gi 1723187   708 AANDLEKAVSGSRLLVVGPEDDEDELMDDVMDDLTGLLDSVDTTGKGVVVQASTLGSLEALLDFLKD--MKIPVMSIGLG 785
gi 14195666  934 LGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKT--SEVPYAGINIG 1011
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470 1072 PVHKKDVMKAGVMLERKKEYATILAFDVKVTTEARELADEMGVKIFCADIIYHLFDLFKAYIENIKEEKKKESADEAVFP 1151
gi 15218159  874 PVHKKDIMKAGVMLEKKKEFATILAFDVKISAEARELADKMGVKIFCDDTIYCLFDKFKSYIEGIKEEKKKETACEAVFP 953
gi 25406462 1039 --YNEGWSDA----REEKEYATILAFDVKVTTEARELADEMGVKIFCADIIYQLFNQFQVYIENIKEEKKKESAGEAVFP 1112
gi 25406471  955 PVHKKDIMKAGVMLEKKKEYATILAFDVKVTTEARELADEMGVKIFCADIIYQLFNQFQVYIENIKEEKKKESAGEAVFP 1034
gi 15226229  417 PVQKKDVMKAGVMLERKKEFATILALDVEVTTEARELADEMEVKIFCSDIMYHLFDQYQAYIC----------------- 479
gi 17556188  965 PVHKKDVQKASAMKEHKAEYACVLAFDVKVEREAQIFADHEGVKVFQADIIYHLQDAFLKYREELKEKARRDNEHLAIFP 1044
gi 19173127  447 TVKKKDMIIVASMAKKHKEYAAILCFDVVLEKEIRDMASSMKVRVFEAKTIYHLLDSYLKFVDEEKEKDKKMYMDQAVFP 526
gi 1723436   865 PVYKKDVMRCATMLEKAKEYALMLCFDVKVDRDAEDLAEQLGVKIFSANVIYHLFDAFTAHQKKILEQKREESSDVAVFP 944
gi 1723187   786 PVYKRDVMKASTMLEKAPEYAVMLCFDVKVDKEAEQYAEQEGIKIFNADVIYHLFDSFTAYQEKLLEERRKDFLDYAIFP 865
gi 14195666 1012 PVHKKDVMKASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFP 1091
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 25406470 1152 CVLQILPNCVFNKKDPIVLGVDVIEGILKIGTPICVPG-------REFIDIGRIASIENN-HKPVDYAKKGNK---VAIK 1220
gi 15218159  954 CILQILPNHIYNQRDPIILGVKVNDGILKVGTPICIVKrie--nvRVFMDIGRVSSIKNNnNMPVDYARKGQE---VAIK 1028
gi 25406462 1113 CVLQILPNCVFNKRDPIILGVKVHDGILKIGTPICVPG-------REFTDIGRIASIENN-HKPVDYAEKGDE---VAIK 1181
gi 25406471 1035 CVLQILPNCVFNKRDPIILGVKVHDGILKIGTPICVPG-------REFTDIGRIASIENN-HKPVDYAEKGDE---VAIK 1103
gi 15226229      --------------------------------------------------------------------------------
gi 17556188 1045 CKLRVLPNHVYNTRNPIVCGVSIEAGIVKRGTPICVPS-------KEGIFLGTISSVQRN-NEEVPSAKQGEE---VCIK 1113
gi 19173127  527 VELSIVPKCIFNSRSPLVVGVHVQEGILKIGTPLCVFKege------ttRLGVVTSIENN-KEAAKEAVKGQK---VAIK 596
gi 1723436   945 CVLKTVA--AFNKRDPIILGVDVVEGVLRINTPIVAVKqlp-ngePQIIELGRVASLEMN-HKPVDKVKKGQAgagVAMK 1020
gi 1723187   866 CVLQTLQ--IINKRGPMIIGVDVLEGTLRVGTPICAVKtdpttkeRQTLILGKVISLEIN-HQPVQEVKKGQTaagVAVR 942
gi 14195666 1092 CKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPS-------KNFVDIGIVTSIEIN-HKQVDVAKKGQE---VCVK 1160
                       1370      1380      1390      1400      1410      1420
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 25406470 1221 IVGSNAEEQKMFGRHFDMEDELVSHISRRSIDILK-SNYRDELSLEEWKLVVKLKNIFKIQ 1280
gi 15218159 1029 IIASNPEEQKMFGRHFGVDDRLISHISSRSVDVIR-TNYWNELSNDEKDLVLRLKRIFKIQ 1088
gi 25406462 1182 IVASNREEQKMFGRHFDMEDELVSHISRRSIDILK-ADYMVSQG----------------- 1224
gi 25406471 1104 IVASNREEQKMFGRHFDMEDELVSHISRRSIDILK-ADYMVSRG----------------- 1146
gi 15226229      -------------------------------------------------------------
gi 17556188 1114 IENTTGEAPRLYGRHFTHEDPLYSRVTRESIDICK-KYFREDLTKADWQLVVQLKKLLEIL 1173
gi 19173127  597 IEAKPNLPPRMFGRHFGQDDILYSLVTRESISVLK-KHFSSELTEDLIRLLNKLENKFGVF 656
gi 1723436  1021 LES--SGSQILFGRQVTESDALYSHITRQSIDSLKdPAFRDEVSRDEWQLIIQLKKLFGII 1079
gi 1723187   943 LEDP-SGQQPIWGRHVDENDTLYSLVSRRSIDTLKdKAFRDQVARSDWLLLKKLKVVFGIE 1002
gi 14195666 1161 IEPIPGESPKMFGRHFEATDILVSKISRQSIDALK-DWFRDEMQKSDWQLIVELKKVFEII 1220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap