Conserved Protein Domain Family
KOG1143

?
KOG1143: KOG1143 
KOG1143, Predicted translation elongation factor [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 229086
View PSSM: KOG1143
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654    1 MESFLSLFDPNQDdgfeEEPELNGNSSGggssssdyETDANANECSVVSGMPTERGNLIFDFEQgMLPPEPQLGNVEYKL 80
gi 17563834   1 MDFMISHFCDEQN----HQPLYKTRRQS--------ISDSKNGPTLLSSSLPTNDECSDSDTEN-RLPPETELGNIEYKA 67
gi 19923499     --------------------------------------------------------------------------------
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654   81 KLVNPSKQRFEHLVTQMKWRLREGNGEAIYEIGVSDAGYLQGLSDKDMNASLTTLKQMAHSLGASTSVLRRKTIAAR--- 157
gi 17563834  68 KLVNPTTSRIQHLITQMKWRLREGQGEAIYEIGVEDGGIMSGLTDEELNDSLRTLRTMAQALGASMVILTEKDVTVKgsn 147
gi 19923499   1 ----------------MKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDsd- 63
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654  158 --RAVAEVLVRKIPDDQHNIEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFD 235
gi 17563834 148 srRTVVEVLVRKVPESQQFIEVRLAVVGGCDVGKSTLCGVLTQGCLDDGNGKARIGIFRFPHEVRTGKTSSVCNDVIGFD 227
gi 19923499  64 mpRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFN 143
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654  236 ALGNVVNykYNEMMTAEEISDRSSKLVTFMDLAGHRRYMRTTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRALDM 315
gi 17563834 228 NRGKLVN--YAQN-SLEEMVEKSSKLVTLIDLAGDAKYQKTTIHGLTGYTPHFACLVVAADRGITWATREHLGLIAALNI 304
gi 19923499 144 SKEEVVN--YSDSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREHLGLALALKV 221
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654  316 PFFVLVTKTDITSP---DATVQELCNLLTTIGCRKVPFVVTNTDEAISAGSN-QISENIVPIFCVSNVTGTGLNLVTKFL 391
gi 17563834 305 PMFVLITKMDLVDRqglKKIIKDVSNLVAKAGMTAREKRVKTKRDAVKAAQE-LCVGSIVPVLAVSSVSGEGFRCLRTLL 383
gi 19923499 222 PFFIVVSKIDLCAKttvERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQfAQSPNVTPIFTLSSVSGESLDLLKVFL 301
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654  392 YVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVGGLLVQGVLTENMAMKIGPLPDGSFHPVTVNTIHRNKAPCRVV 471
gi 17563834 384 NCLSTAGTAESRIQLVGLPAFFTIEELYNVPHVGQVVGGMLSEGQLHEGADVLVGPMKDGTFEKITVGSIRRSRQAVGCV 463
gi 19923499 302 NILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVL 381
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7296654  472 RAGQSASLSFSmDQDVPTLRSGMVLLGDIGNsldePYGTFFFQAKVSVLFHAT-AIYVGFQTTVHIGSIRQTAVIRGIMG 550
gi 17563834 464 NPGEAASISLN-LPDGVSLRRGMVLAEIDHQ----PPVCYEFTANLLLLCHSTkYICEGFQATVFIGSVCTTAIITHIDD 538
gi 19923499 382 RAGQAATLALG-DFDRALLRKGMVMVSPEMN----PTICSVFEAEIVLLFHAT-TFRRGFQVTVHVGNVRQTAVVEKIHA 455
                       570       580       590       600       610
                ....*....|....*....|....*....|....*....|....*....|....
gi 7296654  551 GERLGTNDCASVMFEFVGHPEYVRPGMRILFREGTSKGIGVVTQVFPVNKTGIK 604
gi 17563834 539 ADCIRPGKWAVVKMCFAYQPEVIREGSPIILRQGKTKGMGEVLKVFPCTQ---- 588
gi 19923499 456 KDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQ 509
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap