Conserved Protein Domain Family
KOG1136

?
KOG1136: KOG1136 
KOG1136, Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification]
Statistics
?
PSSM-Id: 229079
View PSSM: KOG1136
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822    1 MPDIKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYIVPEGPITSHIDCVIISHFHLDHCGALPYM 80
gi 25410926   1 -MAIDCLVLGAGQEIGKSCVVVTINGKKIMFDCGMHMGCDDHNRYPNFSLISKSGDFDNAISCIIITHFHMDHVGALPYF 79
gi 17533047   5 IPEIKIVPLGAGQDVGRSCILITIGGKNIMVDCGMHMGYQDDRRFPDFSYIGGGGRLTDYLDCVIISHFHLDHCGSLPHM 84
gi 19074744   1 ---MNVIPLGAGQDVGRSCILVSIKGRTIMFDCGMHMGFNDERRFPDFSYISKTKSFDKVIDCIIISHFHLDHCGALPYF 77
gi 14149863   1 MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALPYF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822   81 SEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLG 160
gi 25410926  80 TEVCGYNGPIYMSYPTKALSPLMLEDYRRVMVDRRGEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLG 159
gi 17533047  85 SEIVGYDGPIYMTYPTKAICPVLLEDYRKVQCDIKGETNFFTSDDIKNCMKKVVGCALHEIIHVDNELSIRAFYAGHVLG 164
gi 19074744  78 TEVCGYGGPIYMTLPTKEVCPVLLDDFRKIVAG-KGDS-IFTYQDISNCMKKVVTISMNETYKHDEDFYITPYYAGHVLG 155
gi 14149863  81 SEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQI---------------- 144
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822  161 AAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDK-CRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPV 239
gi 25410926 160 AVMVYAKMGDAAIVYTGDYNMTTDRHLGAAKIDR-LQLDLLISESTYATTIRGSKYPREREFLQAVHKCVAGGGKALIPS 238
gi 17533047 165 AAMFEIRLGDHSVLYTGDYNMTPDRHLGAARVLPgVRPTVLISESTYATTIRDSKRARERDFLRKVHECVMKGGKVIIPV 244
gi 19074744 156 AAMFHVVVGDQSVVYTGDYSTTPDKHLGPASIKC-IRPDLLITESTYGSITRDCRKVKEREFLKAVSDCVARGGRVLIPI 234
gi 14149863 145 ------KVGSESVVYTGDYNMTPDRHLGAAWIDK-CRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPV 217
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822  240 FALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFDFKHIKPFDKAYIDNPGAM 319
gi 25410926 239 FALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANMYYKMLISWTSQNVKEKHNTHNPFDFKNVKDFDRSLIHAPGPC 318
gi 17533047 245 FALGRAQELCILLESYWERMALNVPIYFSQGLAERANQYYRLFISWTNENIKKTFVERNMFEFKHIKPMEKGCEDQPGPQ 324
gi 19074744 235 FALGRAQELCLLLDGYWERTGLKTPVYFSSGLTEKANEIYKKFISYTNETVRKKIFERNMFEYKHIKPFQRHYMESKGPM 314
gi 14149863 218 FALGRAQEH-------------LHPPGDLLGAHEPEGAHLLLHGADREGQPLLQAVHP--LDQPED-PQDFRAEEHV--- 278
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822  320 VVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGNKILGG-AKKVEFEnRQVVEVKMAVEYMSFSAHADAKGI 398
gi 25410926 319 VLFATPGMLCAGFSLEVFKHWAPSPLNLVALPGYSVAGTVGHKLMAGkPTTVDLYnGTKVDVRCKVHQVAFSPHTDAKGI 398
gi 17533047 325 VLFSTPGMLHGGQSLKVFKKWCSDPLNMIIMPGYCVAGTVGARVING-EKKIEID-QKMHEIRLGVEYMSFSAHADAKGI 402
gi 19074744 315 VLFASPGMLHSGMSLKIFKEWCEDEKNLVIIPGYCVRGTIGEKVLNG-ATKLEIL-GESREIRLEVKNLAFSAHADAPGI 392
gi 14149863     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7301822  399 MQLIQNCEPKNVMLVHGEAGKMKFLRSKIKDEFNLETYMPANGETCVISTP----VKIPVDASVSLLKAEARSY-NAQPP 473
gi 25410926 399 MDLTKFLSPKNVVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTtyikANASDMFLKSCSNPNFKFSnSTQLR 478
gi 17533047 403 MQLIRQCEPQHVMFVHGEASKMEFLKGKVEKEYKVPVHMPANGETVVISAQpkldIRVPLEVCVFLKQIELK-------- 474
gi 19074744 393 LNVVEQCSPRNVMLVHGEKSRMKVLKRSIEERFGIPTFLPPNGTLINIPSRsmvsLRIKKESMSKHFKPNLSRS-MVSLR 471
gi 14149863     --------------------------------------------------------------------------------
                       490       500
                ....*....|....*....|....*
gi 7301822  474 DPKRRRLIHGVLVMKDNRIMLQNLT 498
gi 25410926 479 VTDHRTADGVLVIEKSKKAKIVHQD 503
gi 17533047     -------------------------
gi 19074744 472 MRLSSEKNGCHVDVVDCEDYIEDNT 496
gi 14149863     -------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap