Conserved Protein Domain Family
KOG0881

?
KOG0881: KOG0881 
KOG0881, Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228827
View PSSM: KOG0881
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7291975   12 GIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGSEF 91  fruit fly
15227585   1 MSARPEGSPPEVTLETSMGPFTVEMYYKHSPRTCRNFLELSRRGYYDNVLFHRIVKDFIVQGGDPTGTGRGGESIYGSKF 80  thale cress
17539496   1 MPAPINDQAPYVILDTTMGKIALELYWNHAPRTCQNFSQLAKRNYYNGTIFHRIIADFMIQGGDPTGTGRGGASIYGDKF 80  Caenorhabditis elegans
20177874   3 AIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQF 82  human
3219935    1 --------MANVELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGTGRGGTSIYGDKF 72  fission yeast
7291975   92 ADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMVETDKNDRPVDPLRIIKA 171 fruit fly
15227585  81 EDEINKELKHTGAGILSMANAGPNTNGSQFFITLAPQPSLDGKHTIFGRVCRGMEVIKRLGSVQTDNTDRPIHEVKILRT 160 thale cress
17539496  81 SDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPTQHLDGKHTIFGRVAAGMKVIANMGRVDTDNHDRPKIEIRILKA 160 Caenorhabditis elegans
20177874  83 EDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA 162 human
3219935   73 DDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRMGLIRTDSSDRPIEPLKIIKA 152 fission yeast
7291975  172 KVEK 175 fruit fly
15227585 161 KVID 164 thale cress
17539496 161 YPSE 164 Caenorhabditis elegans
20177874 163 YPSG 166 human
3219935  153 VAL- 155 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap