1QOI


Conserved Protein Domain Family
KOG0879

?
KOG0879: KOG0879 
Click on image for an interactive view with Cn3D
KOG0879, U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228825
View PSSM: KOG0879
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QOI_A     1 MAVANSSPV--NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFR-KDGVPIGYKGSTFHRVIKDFMIQGG 77  human
24586038   7 IQSQLRSSN--NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYR-PDGVPIGYKGASFHRVIKDFMIQGG 83  fruit fly
15224944  20 VEWHVRPPNpkNPVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELR-KAGKPLGYKECQFHRVIKDFMVQSG 98  thale cress
1706257    7 FAEQLRHPD--NPIVFLEVTAGGAPIGTIVIELFADVTPRTAENFRQFCTGEYK-KDGVPNGYKNCTFHRVIKDFMIQGG 83  Caenorhabditis elegans
19112229   1 ------MST--EPVVFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGETLgVNQKPIGYKNSTFHRIIQGFMIQGG 72  fission yeast
1QOI_A    78 DFVNGDGTGVASIYRG-PFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKII-DGLLVMRKIE 155 human
24586038  84 DFVQGDGTGVTSIYGN-TFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVL-DGLLIMRKIE 161 fruit fly
15224944  99 DFLKNDGSGCMSIYGH-KFEDENFTAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVLgDGLLVMRKIE 177 thale cress
1706257   84 DFCNGDGTGLMSIYGS-KFRDENFELKHIGPGMLSMANAGSDTNGCQFFITCAKTDFLDNKHVVFGRVL-DGMLTVRKIE 161 Caenorhabditis elegans
19112229  73 DFVSGDGTGSATIFNSrTFPDENFTLKHDRPGLLSMANAGKDSNGCQFFITTVPCDFLDGKHVVFGEVI-EGYDIVKEIE 151 fission yeast
1QOI_A   156 NVPTGPNNKPKLPVVISQCGEM 177 human
24586038 162 NVPTGPNNKPKLPVTISQCGQM 183 fruit fly
15224944 178 NVAIGPNNRPKLAVVITECGEM 199 thale cress
1706257  162 NVPTGANNKPKLPIVVVQCGQL 183 Caenorhabditis elegans
19112229 152 STPVGANSRPKSNVAIVECGEM 173 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap