Conserved Protein Domain Family
KOG0746

?
KOG0746: KOG0746 
KOG0746, 60S ribosomal protein L3 and related proteins [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 228693
View PSSM: KOG0746
Aligned: 20 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22050357  49 LGFLPQQRSRKHHGKVKSFPKDDPSKLVHLTAFLGYKAGMTNIMR-EVDRPGSKVNKKEVIEAVTIVEIPPMVVVAIVGF 127 human
27735225  14 LGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVR-EVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAY 92  thale cress
21542436  14 LGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVR-DVEKPGSKLHKKETCEAVTIIETPPMVVVGVVGY 92  thale cress
19173222  14 LQFCPRKRSKTIRPAAGAFPADDRSQPVHLTGFMAYKAGMTHVVRtKTQVAKNKQLSREIMDAVTVLEAPPMVVYGIVGY 93  Encephalitozoon cun...
29736516     --------------------------------------------------------------------------------     human
18596957   1 -----------------------------------------------------------------------MMVVGIVGY 9   human
20472413     --------------------------------------------------------------------------------     human
22055156     --------------------------------------------------------------------------------     human
730556    14 LGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVR-DLDRPGSKMHKREILEAVTVIETPPMVVVGVVGY 92  fission yeast
548771    14 LGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVR-DLDRPGSKMHKREILEAVTIIETPPMVVVGVVGY 92  fission yeast
22050357 128 VETPRGLQTFNTVFAEHISDACKRHFYKNRHKSKKKAFTKYCKKCQDEDGKKQLEKDFSSMKKYRQVICIIAYTQMCLLP 207 human
27735225  93 VKTPRGLRSLNTVWAQHLSEEVRRRFYKNWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMK 172 thale cress
21542436  93 VKTPRGLRSLCTVWAQHLSEELRRRFYKNWAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMK 172 thale cress
19173222  94 EKTVTGLRRLPIVTAAYVSDGVLRRMFGNRYASKESAGQFCKGSV-------CES-RVEMIKERAHCVRVLVQTQPTLIK 165 Encephalitozoon cun...
29736516     --------------------------------------------------------------------------------     human
18596957  10 VETPQGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYRKKWQDENGKKQLEKDFSSMKKYCQVIHVIAHTQM---- 85  human
20472413     --------------------------------------------------------------------------------     human
22055156     --------------------------------------------------------------------------------     human
730556    93 VETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKY-AEST-QSINRELERIKKYCSVVRVLAHTQIRKTP 170 fission yeast
548771    93 VETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKY-AEST-QSINRELERIKKYCSVVRVLAHTQIRKTP 170 fission yeast
22050357 208 -LHQRKAHLMEIQVKGGTMAKKLDWAHERLEQQVPVNQVFEQDKMIDVIRLTKGNGYKGVTSRWHTKKLPHKTHRGLCKV 286 human
27735225 173 gLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKV 252 thale cress
21542436 173 gLKQKKAHLNEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKV 252 thale cress
19173222 166 gLGLKKAHIAEIQVNGGSISEKVEWALGRLEKEIAIGEVFGVNENIDTIGVTKGKGFQGTVKRFGVRKQPRKSRKGIRKV 245 Encephalitozoon cun...
29736516   1 ---------------------------------MPAAALPRQE----AEGPMSGSG-----------ELSVRHHA----- 27  human
18596957     --------------------------------------------------------------------------------     human
20472413     --------------------------------------------------------------------------------     human
22055156   1 ---------MTHIVNRGTVAEKLDWAQKRLEQQVPVNQVFGQDEMIKVIGVTKGKGYKGVTSCWHTTKLPHKTHRGLCKV 71  human
730556   171 -LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRLPRKTHRGLRKV 249 fission yeast
548771   171 -LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRLPRKTHRGLRKV 249 fission yeast
22050357 287 ACTGTQHPAPVALPVACIWQKGYCHSTEI-NKIYKISQGyfvrdsKLIKNNASTDYDLHPL-----GAFVHYGEVTNDFV 360 human
27735225 253 ACIGAWHPARVSYTVARAGQNGYHHRTELnKKIYRLGKV------GTEAHTAMTEYDRTEKdvtpmGGFPHYGIVKDDYL 326 thale cress
21542436 253 ACIGAWHPARVSYTVARAGQNGYHHRTEMnKKVYRVGKV------GQETHSAMTEYDRTEKditpmGGFPHYGIVKEDYL 326 thale cress
19173222 246 ACIGAWHPSRVMYSIARAGQMGFHRRTEKnKRVYMIGNGs---------sNIKTEFDLTEKpispmGGFPHYGEVRNDFI 316 Encephalitozoon cun...
29736516  28 ----------IKFSVARAGQKGYHHRTEInKKIYKIGQGylikdgKLIKNNASTDYDLSDKsinplGGFVHYGEVTNDFV 97  human
18596957     --------------------------------------------------------------------------------     human
20472413   1 -------MFAEEVNEEMMGWQRYYQREDEnLELRGPHKPvvkedpVAKMREGARDPDLFEEm----P--R-VGKAG--GH 64  human
22055156  72 ACIGAWHLAHVAFSVSHAGQKGYHHGTEInKKIYKIGQGypimdgKLIKNNASIDYDLSDKsinslGGFVHCGKVTNDFV 151 human
730556   250 ACIGAWHPANVQWTVARAGNAGYMHRTQLnSKIYRIGA-------GDDAKNASTDFDATEKritpmGGFVRYGVVENDFV 322 fission yeast
548771   250 ACIGAWHPANVQWTVARAGNAGYMHRTQLnSKIYRIGA-------GDDAKNASTDFDATEKritpmGGFVRYGVVENDFV 322 fission yeast
22050357 361 MLKDCVVDTKKQVLTLHKSLPVPTKRRPLEKIDLKFIDTTSKFGHGCFQTMEEKTAFMAPLKKDRIAKEEGA 432 human
27735225 327 MIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRVTK--------- 389 thale cress
21542436 327 MIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYGRTIKA-------- 390 thale cress
19173222 317 MVKGAVVGARKRVVTLRKSLLRQ---RAGEELVIKFVDTSSKIGHGRFQTSAEKKAFYGARKADIAAEIH-- 383 Encephalitozoon cuniculi
29736516  98 MLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA 169 human
18596957  86 ------------------------HRRALQKTDLKFTDTTSKFGHGRLQTMEEKKASMGRLKKDQIAKEERA 133 human
20472413  65 MAK-HIHGGPPSVK-LKKLNLHQTKWRVLEKIDLKFIDTTSKFGHGCFQTIEEKKAFMEPLKKDRTAKEE-- 132 human
22055156 152 MLKGYVVGTKKQVLTLCKSLLVQTKWQALEKTDLKFTDTTSNFGHCHFQTMK-KKAFVRPLKKDQIAKEEGA 222 human
730556   323 MLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLKKDVA------ 388 fission yeast
548771   323 MLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLKKDVA------ 388 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap