Conserved Protein Domain Family
KOG0744

?
KOG0744: KOG0744 
KOG0744, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228691
View PSSM: KOG0744
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9755327  110 FSSINGKvntVNEGQDNLFLSLfVKKISIEQQSTSHVSIKLNFHEKINLGQHIDSILdsEETNESDTYHMG---SVDEFI 186
gi 20151587   1 --------------MSFLSNSD-TVHVEVCLRGNDLRSNAIRNNVETALKAYFQTAR--KLPRNVSFLPDL---TAEQTE 60
gi 7485976   16 VQIAVAEpvaTPNPPPCLHENKfLVSVEVCLKPS---STARLEDVQRAVERFVSHFL--IYYNGLVLIPAD---DLFLVD 87
gi 1176794    1 ----------MHEPMKTLKNIH--AEIRICQKFPKSTVQKRFSEFEELIKAASKNARnwKPISSVELFQGDsslNELFEK 68
gi 11321607   1 MDEAVGD---LKQALPCVAESP-TVHVEVHQRGS---STAKKEDINLSVRKLLNRHN--IVFGDYTWTEFD---EPFLTR 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9755327  187 IYP-FCCLEEQDELKNGSILSTEFDKIDLELdeddgFEGETLNNcinSVGNFDIPLSKQTLNLVNISYLPGTTFEGQWES 265
gi 20151587  61 HVHsVLLERDN---GGVQPLKVAETKFRFHF-----YATRPEEGqlgLFSGEEGSDGIDSIVAASHALLPAAQFVGLWEN 132
gi 7485976   88 NVQrICICDT-----DGQPASF------------------------------------------NEWILPAKEFDGLWES 120
gi 1176794   69 LVIgTCELRDGELFENVNDLTINPSN--IHV-----YKLHKDGP---LSQNIGDDDGDESIIGSQLWQLPCVEFDSIWEN 138
gi 11321607  69 NVQsVSIIDTELKVKDSQPIDLSACTVALHI-----FQLNEDGP-----SSENLEEETENIIAANHWVLPAAEFHGLWDS 138
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9755327  266 LYFGNNIKERLYSYATISLKIARFKQTgdsnqediTTLITNNKLLLVHGPPGTGKTTLCKALCQKLSVRrefsdgsdTID 345
gi 20151587 133 LIYETGLKEKLLKFALSALMFSEHRVD--------TNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR--------TQG 196
gi 7485976  121 LIYESGLKQRLLRYAASALLFTQKGVN--------PNLVSWNRIILLHGPPGTGKTSLCKALAQKLSIR--------CNS 184
gi 1176794  139 LIYDSNLKNEVMSYVAALARLSEKHVN--------TKIINVNRLILLTGPPGTGKTSLCKGLAQHLSIR--------MND 202
gi 11321607 139 LVYDVEVKSHLLDYVMTTLLFSDKNVN--------SNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIR--------LSS 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9755327  346 TNYKGIIIELSCARIFSKWFGESSKNISIVFKDIEELLKVnegRGIFICLLIDEVEAIASSRTNLSSRNESTDGIRVVNT 425
gi 20151587 197 SYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSD---PNNLVCVLIDEVESLAYAR-SAMSSNEPRDAMRVVNA 272
gi 7485976  185 RYPHCQLIEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEE---DGNLVFVLIDEVESLAAARKAALSGSEPSDSIRVVNA 261
gi 1176794  203 KYSKSVMLEINSHSLFSKWFSESGKLVQKMFDQIDELAED---EKCMVFVLIDEVESLGMCRESSSSRSEPSDAIRAVNA 279
gi 11321607 203 RYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLIDD---KDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNA 279
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9755327  426 LLTQLDRLKKYHNFLALATSNLLDSLDDAFVDRADGVFYVGNPTAEGILHILKVCIEEMITSGIILFHAR--STGVKFFN 503
gi 20151587 273 VLTQLDSLKTCPNVLILATSNLAQSIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREV------L-ESE 345
gi 7485976  262 LLTQMDKLKSAPNVIILTTSNITTAIDVAFVDRADIKAYVGPPTLHVRYEILRSCVEELISKGIISSFQ---SVKIKLRI 338
gi 1176794  280 LLTQIDRIRRRDNVLILCTSNLESTLDKALVDRADIVKNVGQPSDFARYSMLKSSIMELARIGVVIDNEVh-TDYWPQDI 358
gi 11321607 280 VLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQllTLRELEMI 359
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 9755327  504 KYQDILRKIAIKCS------TVDISGRTIRKLPLMCLSEYFRT------FPVDDDEFVLALAMSARKLSAARK 564
gi 20151587 346 DAEEGLLTQLAERS-------VGLSGRTLRKLPLLAHAQYTSStlfeldQKISLSDFLDAMLEALEQHLGEQR 411
gi 7485976  339 LLKKASMNWDQLLD------VQGLSGRSLRKLPFLAHAALADP------YSHDPSNFLCTMIETAKREKSEQP 399
gi 1176794  359 CDTKAPRNEFTEILfkiaqeARGLSGRAISMLPTLVYSKSPEE-------TITLPNCMNLFLEAVKERLSRNN 424
gi 11321607 360 GFIENNVSKLSLLLndisrkSEGLSGRVLRKLPFLAHALYVQA------PTVTIEGFLQALSLAVDKQFEERK 426
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap