Conserved Protein Domain Family
KOG0744

?
KOG0744: KOG0744 
KOG0744, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228691
View PSSM: KOG0744
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9755327  110 FSSINGKvntVNEGQDNLFLSLfVKKISIEQQSTSHVSIKLNFHEKINLGQHIDSILdsEETNESDTYHMG---SVDEFI 186 baker's yeast
20151587   1 --------------MSFLSNSD-TVHVEVCLRGNDLRSNAIRNNVETALKAYFQTAR--KLPRNVSFLPDL---TAEQTE 60  fruit fly
7485976   16 VQIAVAEpvaTPNPPPCLHENKfLVSVEVCLKPS---STARLEDVQRAVERFVSHFL--IYYNGLVLIPAD---DLFLVD 87  thale cress
1176794    1 ----------MHEPMKTLKNIH--AEIRICQKFPKSTVQKRFSEFEELIKAASKNARnwKPISSVELFQGDsslNELFEK 68  Caenorhabditis elegans
11321607   1 MDEAVGD---LKQALPCVAESP-TVHVEVHQRGS---STAKKEDINLSVRKLLNRHN--IVFGDYTWTEFD---EPFLTR 68  human
9755327  187 IYP-FCCLEEQDELKNGSILSTEFDKIDLELdeddgFEGETLNNcinSVGNFDIPLSKQTLNLVNISYLPGTTFEGQWES 265 baker's yeast
20151587  61 HVHsVLLERDN---GGVQPLKVAETKFRFHF-----YATRPEEGqlgLFSGEEGSDGIDSIVAASHALLPAAQFVGLWEN 132 fruit fly
7485976   88 NVQrICICDT-----DGQPASF------------------------------------------NEWILPAKEFDGLWES 120 thale cress
1176794   69 LVIgTCELRDGELFENVNDLTINPSN--IHV-----YKLHKDGP---LSQNIGDDDGDESIIGSQLWQLPCVEFDSIWEN 138 Caenorhabditis elegans
11321607  69 NVQsVSIIDTELKVKDSQPIDLSACTVALHI-----FQLNEDGP-----SSENLEEETENIIAANHWVLPAAEFHGLWDS 138 human
9755327  266 LYFGNNIKERLYSYATISLKIARFKQTgdsnqediTTLITNNKLLLVHGPPGTGKTTLCKALCQKLSVRrefsdgsdTID 345 baker's yeast
20151587 133 LIYETGLKEKLLKFALSALMFSEHRVD--------TNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR--------TQG 196 fruit fly
7485976  121 LIYESGLKQRLLRYAASALLFTQKGVN--------PNLVSWNRIILLHGPPGTGKTSLCKALAQKLSIR--------CNS 184 thale cress
1176794  139 LIYDSNLKNEVMSYVAALARLSEKHVN--------TKIINVNRLILLTGPPGTGKTSLCKGLAQHLSIR--------MND 202 Caenorhabditis elegans
11321607 139 LVYDVEVKSHLLDYVMTTLLFSDKNVN--------SNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIR--------LSS 202 human
9755327  346 TNYKGIIIELSCARIFSKWFGESSKNISIVFKDIEELLKVnegRGIFICLLIDEVEAIASSRTNLSSRNESTDGIRVVNT 425 baker's yeast
20151587 197 SYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSD---PNNLVCVLIDEVESLAYAR-SAMSSNEPRDAMRVVNA 272 fruit fly
7485976  185 RYPHCQLIEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEE---DGNLVFVLIDEVESLAAARKAALSGSEPSDSIRVVNA 261 thale cress
1176794  203 KYSKSVMLEINSHSLFSKWFSESGKLVQKMFDQIDELAED---EKCMVFVLIDEVESLGMCRESSSSRSEPSDAIRAVNA 279 Caenorhabditis elegans
11321607 203 RYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLIDD---KDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNA 279 human
9755327  426 LLTQLDRLKKYHNFLALATSNLLDSLDDAFVDRADGVFYVGNPTAEGILHILKVCIEEMITSGIILFHAR--STGVKFFN 503 baker's yeast
20151587 273 VLTQLDSLKTCPNVLILATSNLAQSIDLAFVDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREV------L-ESE 345 fruit fly
7485976  262 LLTQMDKLKSAPNVIILTTSNITTAIDVAFVDRADIKAYVGPPTLHVRYEILRSCVEELISKGIISSFQ---SVKIKLRI 338 thale cress
1176794  280 LLTQIDRIRRRDNVLILCTSNLESTLDKALVDRADIVKNVGQPSDFARYSMLKSSIMELARIGVVIDNEVh-TDYWPQDI 358 Caenorhabditis elegans
11321607 280 VLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQllTLRELEMI 359 human
9755327  504 KYQDILRKIAIKCS------TVDISGRTIRKLPLMCLSEYFRT------FPVDDDEFVLALAMSARKLSAARK 564 baker's yeast
20151587 346 DAEEGLLTQLAERS-------VGLSGRTLRKLPLLAHAQYTSStlfeldQKISLSDFLDAMLEALEQHLGEQR 411 fruit fly
7485976  339 LLKKASMNWDQLLD------VQGLSGRSLRKLPFLAHAALADP------YSHDPSNFLCTMIETAKREKSEQP 399 thale cress
1176794  359 CDTKAPRNEFTEILfkiaqeARGLSGRAISMLPTLVYSKSPEE-------TITLPNCMNLFLEAVKERLSRNN 424 Caenorhabditis elegans
11321607 360 GFIENNVSKLSLLLndisrkSEGLSGRVLRKLPFLAHALYVQA------PTVTIEGFLQALSLAVDKQFEERK 426 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap