Conserved Protein Domain Family
KOG0741

?
KOG0741: KOG0741 
KOG0741, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228688
View PSSM: KOG0741
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6226660   58 PSYQTSN-EKMFRVRKAPSEEHTLANYAYVNRSDFDDKQIKH--------VRVNpgpahHYIFSIRND---GSIKPGEIA 125 Caenorhabditis elegans
1171772    1 ------M-AYILKATKCPTDELSLTNRAIVNVGDF-PEEIKYadispapgQ--------HFIFALEKT---VEVPSGYVG 61  fruit fly
25289964   1 MAGRYGSqVMTMTVTNTPSADLAFTNLAYCSSSDLRQFSVPG--------SDLFlanksRLLWSVTMLnlfIVIRDGNIA 72  thale cress
19173098   1 MKYIVSN-IKADQVEKGKINKIYIPRAPELDPSEF----V-L--------VDN------KYAFKFEFT------SGCNLQ 54  Encephalitozoon cun...
1171773    1 -----MA-GRSMQAARCPTDELSLTNCSVVNEKDF-QSGQHV--------IVRTsp-nhRYTFTLKTH---PSVVPGSIA 61  human
15214289  50 THMDVRRpSGPFRIVKATSTEDALTNCIIVSPMDFK-QQYII--------VDNS------RVFSTKPV---PGFPQGCLG 111 fission yeast
585965    20 TNMDTR--TRHLKVSNCPNNSYALANVAAVSPNDFPNNIYII--------IDNL------FVFTTRHS---NDIPPGTIG 80  baker's yeast
134267     1 -----------------------magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvp 57  Chinese hamster
6226660  126 FGVPHRKWAALSLD-QEVRVT---PFTFQQS-EYVGSMILTADFNAKKNVTSEPLNADLMAREFSIQFGGQAFSKGMQMA 200 Caenorhabditis elegans
1171772   62 FSLVQRKWAMVSIN-QELEVR---PYRFDASsDVITCVSFETDFLQKKTVSQEPYDSDQMAKEFIMQFAGMALTVGQSLV 137 fruit fly
25289964  73 LNAIQRRHARVSTG-DMVSVS---RFVPPEN-FDLAMLTLELEFVKKG-TKSEQVDAALLSTQLKRKYTNQVLTVGQKAT 146 thale cress
19173098  55 LSKIQREFLNKSVGkDEINVK----HLNVVEcDPISLLKLDVELINLE---KVDFDAKELIEQFKNIYVSFPFNVDQRFY 127 Encephalitozoon cun...
1171773   62 FSLPQRKWAGLSIG-QEIEVS---LYTFDKAkQCIGTMTIEIDFLQKKSNDSNPYDTDKMAAEFIQQFNNQAYSVGQQLV 137 human
15214289 112 ASQPHREWASWSLN-QQVHVAdydPYGPHGa-PYLHSMTLEVDFQNRNRTTNEPFDGEEMAKLFCSSYQSQVFSPGQKIV 189 fission yeast
585965    81 FNGNQRTWGGWSLN-QDVQAKafdLFKYSGKqSYLGSIDIDISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYLI 159 baker's yeast
134267    58 gsvafslpqrkwaglsigqeievalysfdkakqcigtMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLV 137 Chinese hamster
6226660  201 FRFEDkeknkTHTLSLVVKSIEGFDIGkaaaaasgASNTDSSATKPKQIEAGELLPNSVIVFDKEEGSMLNLIGKSKGKS 280 Caenorhabditis elegans
1171772  138 FNFKD-----KKLLGLAVKSLEAIDP---------KSLGEGKDTAMRNVRFGRILGNTVVQFEKAENSSLNLQGKSKGKV 203 fruit fly
25289964 147 FEYHGt----NYILTVNRADVEGQDH-------------------TNGIERGLLSKDTYIVFEASNASGIKIVNQ-REAA 202 thale cress
19173098 128 LYLGN--------LGFKVVVREMFTA--------------------LDRRYGILLRNTEV-FISSVSDRLTLSNN----T 174 Encephalitozoon cun...
1171773  138 FSFN------EKLFGLLVKDIESMDPS--------ILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKE 203 human
15214289 190 FDFRS------YNIKATVRTISCVDLL--------IGENQDAENTADTSKRGLLTSQTEIQFFKAAHSALRLKAS-MTRP 254 fission yeast
585965   160 MEFQG------HFFDLKIRNVQAIDLG--------DIEPTSAVATGIETK-GILTKQTQINFFKGRDGLVNLKSSNSLRP 224 baker's yeast
134267   138 FSFN------DKLFGLLVKDIEAMDPS--------ILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKE 203 Chinese hamster
6226660  281 AYRSIINPDWDFQQMGIGGLDTEFSHIFRRAFASRVFPPEFIEQLGMKHVRGILLFGPPGTGKTLMARQIGKMLNAREPK 360 Caenorhabditis elegans
1171772  204 VRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPK 283 fruit fly
25289964 203 SSNIFKHKEFNLESLGIGGLGAEFADIFRRAFASRVFPPHVTSRLGIKHVKGMLLFGPPGTGKTLMARQIGKMLNGKDPK 282 thale cress
19173098 175 KENILLDPNFNFESLGIGGLKQEFGKMFRRAFVQRAFDSDVIKNFGIPHVKGIILYGPPGTGKTLIARKLGSLLNARPPK 254 Encephalitozoon cun...
1171773  204 NRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFAFRVFPPEIVEQMGCIHVKGILLYGPPGCGKTLLARQIGKMLNAREPK 283 human
15214289 255 ASNAILQPGFKFEDMGIGGLDSEFSAIFRRAFASRLFPPGMVEKLGINHVKGILLYGPPGTGKTLIARQIGKMLNAREPK 334 fission yeast
585965   225 RSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNAKEPK 304 baker's yeast
134267   204 NRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPK 283 Chinese hamster
6226660  361 IVNGPQILDKYVGESESNVRKLFADAEEEWRRCGANSGLHIIIFDEIDAICKQRGSMAGSSSVHDTVVNQLLSKMDGVEQ 440 Caenorhabditis elegans
1171772  284 IVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQ 363 fruit fly
25289964 283 IVNGPEVLSKFVGETEKNVRDLFADAEQDQRTLGDASELHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVEA 362 thale cress
19173098 255 IVNGPEILNKYVGQSEENIRNLFKDAEEEWKVKKGDSNLHIIIFDEIDAICRRRGNSSG-TGVGDQVVNQLLSKMDGVES 333 Encephalitozoon cun...
1171773  284 VVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQ 363 human
15214289 335 IVNGPEILNKYVGQSEENVRKLFADAEREYRDRGEESGLHIIIFDELDAICKKRGSSGGDTGVGDQVVNQLLAKMDGVDQ 414 fission yeast
585965   305 IVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQ 384 baker's yeast
134267   284 VVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQ 363 Chinese hamster
6226660  441 LNNILVIGMTNRRDMIDEALLRPGRLEVQMEVSLPDETGRLQILKIHTARMREYNKMDPNVDLEDISKRTKNFSGAELEG 520 Caenorhabditis elegans
1171772  364 LNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEG 443 fruit fly
25289964 363 LNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDEAGRLQILQIHTNKMKENSFLGTDINLQELAARTKNYSGAELEG 442 thale cress
19173098 334 IENILVIGMTNRLDLIDEALLRPGRFEIHLEISLPDEESRIEIYRIHTKTMESHDYLDANVDLNKIARLSKNYTGAEITA 413 Encephalitozoon cun...
1171773  364 LNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEG 443 human
15214289 415 LNNILVIGMTNRKDMIDEALLRPGRLEVHMEISLPDEHGRLQILKIHTSRMASNGILENDVDMEELASLTKNFSGAEIAG 494 fission yeast
585965   385 LNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPDEKGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEG 464 baker's yeast
134267   364 LNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEG 443 Chinese hamster
6226660  521 LVRAAQSSAMNRLVKAG-GK-AQADPDAIEKLAINSGDFDYALEnDIKPAFGRSDESLNRFLSRGMIVWGPEVTKILDEG 598 Caenorhabditis elegans
1171772  444 LVRAAQSSAMNRLIKAD-AK-VTVDPEAMEKLKVNRDDFLHSLEhDIKPAFGTAQEILDNMLARGVINWGAPVSNLLEDG 521 fruit fly
25289964 443 VVKSATSYALNRQLSMD----DLTKPVEEENIKITMEDFLHAIY-EVQPAFGASTDDLERCRLNGMVDCGHRHNHIYKRA 517 thale cress
19173098 414 VVKSAVSFALERKVHGEkLDgERMNVVGDKNIKVYMNDFIQALD-EVKPSFGINELEFSRFEKT--FYETPMFTQGVEHG 490 Encephalitozoon cun...
1171773  444 LVRAAQSTAMNRHIKAS-TK-VEVDMEKAESLQVTRGDFLASLEnDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDG 521 human
15214289 495 LIKSASSFAFYRHIKVG--T-TAAVSGNLENIKVNRNDFLNALS-EVRPAYGVSEEELESRVQGGIINFGKHIEEIITEG 570 fission yeast
585965   465 LVKSASSFAINKTVNIGkGA-TKLNTKDIAKLKVTREDFLNALN-DVTPAFGISEEDLKTCVEGGMMLYSERVNSILKNG 542 baker's yeast
134267   444 LVRAAQSTAMNRHIKAS-TK-VEVDMEKAESLQVTRGDFLASLEnDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDG 521 Chinese hamster
6226660  599 SLLAATVKNPENSGFRTVVLAGAAKTGKTSLAAQMAKSSDFPFVKVISPEDTVGFSESAKCMALKKAFEDAKRSKLSVLL 678 Caenorhabditis elegans
1171772  522 MLYVQQAKAPESSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMVGYTESAKCLHIRKIFDDAYRSMLSCIV 601 fruit fly
25289964 518 MLLVEQVKVSTRSPLVTCLLEGPSGSGKTALAATIGIDSDFPYVKIVSAETMIGLSESTKCAHIVKVFEDAYKSPMSIII 597 thale cress
19173098 491 KNLLTKLRKTNLYSTSSLLFHGCPGVGKTTLAVKAARSSMFPFIKIISPRDIIGLSEYEKVNYIKGKFMDAYKSEEAIII 570 Encephalitozoon cun...
1171773  522 ELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVV 601 human
15214289 571 KLFVQQVKNSERTRLVSVLLSGPIASGKTALAATIALGSEFPFVKLVSAESMVGMNENARVAHVNRVFEDSYKSPLSVIV 650 fission yeast
585965   543 ARYVRQVRESDKSRLVSLLIHGPAGSGKTALAAEIALKSGFPFIRLISPNELSGMSESAKIAYIDNTFRDAYKSPLNILV 622 baker's yeast
134267   522 ELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVV 601 Chinese hamster
6226660  679 IDNLERLIDYHPVGPRYSNLVIQALLVLLNAPPPAGHRLFVIATSSDRMFLRDMGLMDVFGDVIDIPKLTTAGQMMNVIQ 758 Caenorhabditis elegans
1171772  602 VDNVERLLDYGSIGPRYSNMTLQALLVLLKKQPPKGRKLLILCTSSRREVLEEMEMLTAFTSVLHVPNLSKPDHVLAVLE 681 fruit fly
25289964 598 LDDIERLLEFIAIGPRFSNIISQTLMVLLKRLPPKGKKLLVFGTTSEVTFLESVGISDCFSVTHSVPTLQK-EDAKKVLN 676 thale cress
19173098 571 LDDIEGLIDFVNIGPRFSNAVLQALKIFIKEESRK--KMFVFGTTSSVEVMRECGIYECFQSAYEVEKIGF--PDYEILC 646 Encephalitozoon cun...
1171773  602 VDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALE 681 human
15214289 651 VDEIERIIDWVPIGPRFSNTLLQTLMVLFKKQPPKGHRLLILATTSERTMLSRMDMTQSFDAEIAVPNVSNVTELDRIIQ 730 fission yeast
585965   623 IDSLETLVDWVPIGPRFSNNILQMLKVALKRKPPQDRRLLIMTTTSAYSVLQQMDILSCFDNEIAVPNMTNLDELNNVMI 702 baker's yeast
134267   602 VDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALE 681 Chinese hamster
6226660  759 ESNIYSDDQLPMIEQKLASICrgegfHGVGIKHLLELIESARQCEADYRVPTLLNMMEGLALNLYR 824 Caenorhabditis elegans
1171772  682 NTDIFSKGEIQAIGKKMAGKR-----VFIGIKKLLGLIDMARQTEQSQRAIKFLSKMEEEGGLDMV 742 fruit fly
25289964 677 QLNLFSEDDVDSAAEALND--------MP-IKKIYMLIEMAAQGENGGSAEAIYAGREKININHFY 733 thale cress
19173098 647 RQN---PSFSEICYEEPMS-----------IKQLLSLLDEPDISPQ-------------------- 678 Encephalitozoon cuniculi
1171773  682 LLGNLKDKERTTIAQQVKGKK-----VWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLD 742 human
15214289 731 SIDSFADSNVRADTLQRLQNFtgtdaVNVGVAKILMIAETAKQDVDV--VSCFVEAMARAIPME-- 792 fission yeast
585965   703 ESN-FLDDAGRVKVINELSrsc--pnFNVGIKKTLTNIETARHDEDP--VNELVELMTQSA----- 758 baker's yeast
134267   682 LLGNFKDKERTTIAQQVKGKK-----VWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLD 742 Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap