Conserved Protein Domain Family
KOG0735

?
KOG0735: KOG0735 
KOG0735, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228682
View PSSM: KOG0735
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613    13 GGAAVTVAFTNARDCFLHLPRRLVAQLHLLQN---QAIEVVWSHQPAFLSWVEGrHFSDQGENVAEINRQVGQKLGLSNG 89
gi 7294415     2 FKRTFKVVYRPIRSNFVLLPDQYYGVVSTYDTg---CLSLQYNGRTHYASWAPQkGGGGIKDTEIGINARAAKEIGLHEN 78
gi 9759341    14 METEAVVNTVAGVDCFVSLPRQLLHALQSTSSsplPPLLPVELRSGDRRWSVAW-SGSSSSSSAIEIARVFAESISLPDG 92
gi 7495873       --------------------------------------------------------------------------------
gi 19075270    1 --MRCIVSYKSLRSCLVNVPELLLESISEPVQn--YAVQAVVCKNDIKKTFYFG-ISGIPSQFSFEIDSTYAHTLKLAEN 75
gi 548458     16 FSNAIVGNFLRLPHSIINVLESTNYAIQEFG----IAVHSHNSDIPIVHLGWDG-HDSGSSENVVLINPVLATVYDLNQK 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613    90 GQVF---LKPCSHVVSCQQVEVEPLSADDWEILELHAVSLEQH-LLDQIRIVFPkAIFPVWVDQQTYIFIQIVALIPAAS 165
gi 7294415    79 DLVK---CALIADVLNLRSVHVTPVSSKDWEIIELSTEKISGS-VLEQTRIVNStQILIVWINKSMQVALTVDRLKPHMN 154
gi 9759341    93 TVVK---VRVLPNVPKATLVTVEPETEDDWEVLELNAELAEAA-ILSQVRILHEtMKFPLWLHDRTVIRFSVVSTFPSKG 168
gi 7495873       --------------------------------------------------------------------------------
gi 19075270   76 QEIN---LSIIDCTHEIEQLEIEPVTSNDWEIAERNAAWLEEN-LLVQYRVATT-ERFIIYLPSGTFIQFQPLKLIPSSL 150
gi 548458     91 SPLVdlyIQRYDHTHLATEVYVTPETSDDWEIIDANAMRFQNGeILHQTRIVTP-GETLICYLEGIVTKFKIDRVEPSMK 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   166 YGRLETDTKLLIQPKTRRAKENTFSKADAEYKKLHSygrdqkgmmKELQTKQLQSNTVGITESNENESEIPVds--sSVA 243
gi 7294415   155 YGRIDHNTELVVAPNLYKGLTNGTSNGVIEENTKLS---------RSKTTAQVKDELTEKLTPLTHSSTVSNv---kNTI 222
gi 9759341   169 VVQLVPGTEVAVAPKRRDRNLKAKKSQEKECNNVKAllr----vqETDRSAFHEADVKGFELRVALTSIAYIhpetaKKH 244
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  151 CGRLLRTTEVLITPKPNTSAIEVKEN----------------------RKVNLRCVVENRLLPDS--------------- 193
gi 548458    170 SARITDGSLVVVAPKVNKTRLVKAEYGHSNKTILKNga------iQLLKKVILRSTVCKMDFPKDNLFVVYIs----DGA 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   244 SLWTMIGSIFSFQSEKKQeTSWGLTEINAFKNMQSKVVPLDnifRVCKSQPPSIynasat---svfhkHCAIHVFPWDQE 320
gi 7294415   223 QRNKRQDHMERLKKDLRReSSRSFEFRVIRGLWREQAQESDv--FVNGKHLPEFfdldl-----fycmHTAADKDYYVRV 295
gi 9759341   245 SLESLQLISVSPRIPLKG-SAKKDEALNMKNSEASKVAENG---TSSAKKEPRQailrlvfsdlaakgHLMMVESLRLYL 320
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  194 --VTADSPALCVFLPLNF-PDRPDVVYMDGGNLKSTIVCQC---VSCPFQIPG---------------HFFISKSLALSY 252
gi 548458    240 QLPSQKGYASIVKCSLRQ-SKKSDSDNKSVG-IPSKKIGVF---IKCDSQIPEN--------------HIALSSHLWDAF 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   321 YFdvepsftvtygklvkllspkqqqskt----kqnvlspekekqmsepldqkkirsdhNEEDEKACVLQVVWNgleeLNN 396
gi 7294415   296 RT--------------------------------------------------------VEDDIEDDLPETIHPsi-eLNA 318
gi 9759341   321 GAglhswvylrgcnvnedkeipalslspcvfkisenekvldkgtdrlgnnnsvrksshPPSGLSTYVDVVDWS----VHD 396
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  253 S-------------------------------------------------------------IKTGFKFQIWK----AHN 267
gi 548458    301 FTh-------------------------------------------------------PMNGAKIKLEFLQMN----QAN 321
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   397 AIKYTKNVEVLHLgkVWIPDDLRKRLN--------IEMHAVVRITpvevTPKIPR--SLKLQPRENLPKDISEEDIKTVF 466
gi 7294415   319 NLMKLLGIKELERv-VLRPKTTVVNFVe------kIELFANKKTH----YKIMEN--AFKRFVIERTQHKPMLFNQEEVV 385
gi 9759341   397 KVVTALSSEGLHD--EGNHDKNKKGLEyltrlwslAQLDAMASVTgvdvSSLIVGreTFFHFEVRGLESYKSIDGQPSVN 474
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  268 PPSSSKFILEQK----GLPPES--NLS--------SELVAAKLKN----SYLMDGm-TLKLVDIAVSYSVSGLS------ 322
gi 548458    322 IISGRNATVNIKY--FGKDVPTKSGDQy-------SKLLGGSLLT----NNLILPt-EQIIIEIKKGESEQQLCNLNEIS 387
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   467 YSWLQQSTTTMLPLVISEEEFIKLETKDGLKEFSLSIVHSWEKekdknifllspnllqkttIQVLLDPMVKEENSEeiDF 546
gi 7294415   386 RLEDDLLVTVGILPEHFRYCVVDAQFLKESKIYAADLVRPVGEiikeetp----ptsplsvQDLIQLPEYDKIVDQvvQE 461
gi 9759341   475 DRWESGKKDKHTPLEILYVMTVSDESLLGDKFAGYDLSLDRSEksdnvvhie-pvlekmnlGEPIYLKSAKETHCN--KG 551
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  323 ------GVVKNPIQDIKITSDTNVPVNAGIRNNSPRLSMQPFP------------------HEFAQVR-----NA----- 368
gi 548458    388 NESVQWKVTQMGKEEVKDIIERHLPKHYHVKETGEVSRTSKDE------------------DDFITVNSIKKEMVN--YL 447
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   547 ILPflklsslggvnslgvsslehithsllgrplsrqlmslvaGLRNGALLLTGGKGSGKSTLAKAICKEAF--DKLDAHV 624
gi 7294415   462 LRMnlcls------------------------------adnsVMRQCNVLLAGASGTGKTVLVERILDQLSr-KPDYCHF 510
gi 9759341   552 VSPdissltwmgpivsdvikr----mtvllspaagmwfskfkIPSPGHILIYGPPGSGKTILARAAAKYFEeqKDLLAHV 627
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  369 ------------------------------------------VFLHQNIYINGPKGCGKSNLVHSLFDYYS--LNSIYFQ 404
gi 548458    448 TSP---------------------------------------IIATPAIILDGKQGIGKTRLLKELINEVE--KDHHIFV 486
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   625 ERVDCKALRGKR-LENIQKTLEVAFSEAVWMQPSVVLLDDLDLIAGlp---aVPEHEHSPDAVQSQRLAHALNDMIKEFI 700
gi 7294415   511 EFFHGSRSKGRK-TESIQKDLRNIFTSCLQHAPAIVVLENLDVLAH------AAGEQSSQDGEYYNRMADTVYQLIVQYT 583
gi 9759341   628 ILVSCSTLALEK-VQHIHHVLSSVIAEGLEHAPSVIILDDLDSIISs-----SSDTEGTQASVGVTMLTKFLTDVIDDYG 701
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  405 MIVSCSEIDRSS-FAKFQSFWNNVFIQAERYEPSIIYLDDVHCLIS-------SSNENGELGFVEEREIAFL-QHQIINL 475
gi 548458    487 KYADCETLHETSnLDKTQKLIMEWCSFCYWYGPSLIVLDNVEALFGkpqandGDPSNNGQWDNASKLLNFFINQVTKIFN 566
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   701 SMGSL------VALIATSQSQQSLHPLLVSAQgvhIFQCVQHIQPPNQEQRCEILCNVIKNKLdcDINKFTDLDLqhVAK 774
gi 7294415   584 TNNAI-------AVIATVNELQTLNKRLSSPRgrhVFQTVARLPNLERADREIILRELCSHIN-----VAKDLDLvkFSN 651
gi 9759341   702 EYRNSscgigpLAFVASVQSLEQIPQTLSSSG---RFDFHVQLAAPATSERGAILKHEIQKRL--LDCSEDILLN--LAA 774
gi 7495873       --------------------------------------------------------------------------------
gi 19075270  476 KRKRK------IIFIGFGEEFLTFSENLVLPL---LFQIKIALPSLAVTRRKEILTTIFQENF--SDITMDSIEF--ISV 542
gi 548458    567 KDNKR------IRVLFSGKQKTQINPLLFDKH---FVSETWSLRAPDKHARAKLLEYFFSKNQ--IMKLNRDLQFsdLSL 635
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   775 ETGGFVARDFTVLVDRAIHSRLs--RQSISTREKlVLTTLDFQKALRGFLPASLRSVNLHKPRD-------LGWDKIGGL 845
gi 7294415   652 LTEGYRKCDLVQFVERAIFYAY-----RISKTQP-LLTNDQLIESLEHTNSYCLQGIQSNQRTGndadaneMRVEELPGL 725
gi 9759341   775 KCEGYDAYDLEILVDRAVHAAIgrhLPLESNISKyNLVKEDFTRAMHDFVPVAMRDITKSASEGg-----rLGWEDVGGV 849
gi 7495873     1 -------------------------------------------------------------------------MEDVGGM 7
gi 19075270  543 KTEGYLMTDLVLFVKRLLSEAF---VEKIQNGPKhLMNKGLIEKTLKDFVPLQLRKAKFVKSS--------IRWIDIAGM 611
gi 548458    636 ETEGFSPLDLEIFTEKIFYDLQ---LERDCDN---VVTRELFSKSLSAFTPSALRGVKLTKETN-------IKWGDIGAL 702
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   846 HEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVIARESRMNFISVKGPELLSKYIGASEQAVRDI 925
gi 7294415   726 ESVVGVLEEVLMWPSRYPTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIISVKGPELLAKYIGQSEENVRNL 805
gi 9759341   850 TDIKNAIKEMIELPSKFPKIFAKSPLRLRSNVLLYGPPGCGKTHIVGAAAAACSLRFISVKGPELLNKYIGASEQAVRDI 929
gi 7495873     8 FEQKKLLEQVIIWPRKYPQLFESVGVPVSKGILLHGPSGCGKTLLANATISNSNFSVVNVKGPELLSKYIGASEENVRLV 87
gi 19075270  612 QEAKEAVRDIIESPVKYSLIYKQCRLRLPTGILLFGYPGCGKTYLASAISSTFPVQFISIKGPELLDKYIGKSEQGVRDL 691
gi 548458    703 ANAKDVLLETLEWPTKYEPIFVNCPLRLRSGILLYGYPGCGKTLLASAVAQQCGLNFISVKGPEILNKFIGASEQNIREL 782
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613   926 FIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEG-LQGVYVLAATSRPDLIDPALLRPGRLDKCVY 1004
gi 7294415   806 FNRARSARPCVLFFDEFDSLAPKRGHDSTGVTDRVVNQLLTELDGVEG-LQGVTVIAATSRPELLDPALLRSGRIDRLVE 884
gi 9759341   930 FSKAAAAAPCILFFDEFDSIAPKRGHDNTGVTDRVVNQFLTELDGVEV-LTGVFVFAATSRPDLLDPALLRPGRLDRLLL 1008
gi 7495873    88 FEKARSCAPCILFFDELDSLAPKRGHDSTGVTDRVVNQLLTELDGAEGgMKGVIILGCTSRIDLIDDALLRPGRFDHHVY 167
gi 19075270  692 FSRAQMAKPCVLFFDEFDSVAPRRGQDSTGVTDRVVNQILTQMDGAES-LDGVYIVAATTRPDMIDPALLRPGRLDKLIF 770
gi 548458    783 FERAQSVKPCILFFDEFDSIAPKRGHDSTGVTDRVVNQLLTQMDGAEG-LDGVYILAATSRPDLIDSALLRPGRLDKSVI 861
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134613  1005 CPPPDQVSRLEILNVLSDSLPLAD---------DVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGl-QDGSSS 1074
gi 7294415   885 CPLPDAPARVRIFEALSSTLSLDE---------CVDFDWFAGKTANYTGADIQSILTSANMAAVKEALAQFG--HEKLAK 953
gi 9759341  1009 CDFPSPPERLEILTVLSRKLLMAD---------DIDLEPIALMTEGFSGADLQALLSDAQLAAVHEYLNREDkpETGTTP 1079
gi 7495873   168 CGHPEKTERLDIMKVLTN-KLKPT---------DVDFECLAQKTDGWSGADLQLLFTNAQFYNARQIAKEEDglEEDNVP 237
gi 19075270  771 CDLPNEEERLEVLQKLANRFHIEN---------AAMLKKLSTLTDGYTYADLSSLLYDAHLIAVHKLLKRVS--INAVDP 839
gi 548458    862 CNIPTESERLDILQAIVNSKDKDTgqkkfalekNADLKLIAEKTAGFSGADLQGLCYNAYLKSVHRWLSAAD--QSEVVP 939
                       1130      1140      1150      1160      1170      1180
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 8134613  1075 SDSDLSLSSMVFLnhsSGSDDSAGDGECGLDQSLVslemSEILPDEskfnmYRLYFGSSYESEL 1138
gi 7294415   954 KISLKQKHLIESF---QTTRPSLSASDVAKYHRTY----ARFTNKEk----TSREFVAKRATLA 1006
gi 9759341  1080 IITDPLLKSIAS-----KTKPSVSETEKQKLYDIY----SQFLDSR-----KSVSLSSPL---- 1125
gi 7495873   238 -IDQASIESVFND---SIPKPKRSQVDNRIGQKVT----LA----------------------- 270
gi 19075270  840 SQTTSSFTNLTTE---SKRNASMLALPPESRYNQN----MQSMSDS-----KSVVIEDYMLMEA 891
gi 548458    940 GNDNIEYFSINEH---GRREENRLRLKTLLQQDVV----HETKTSTsaaseLTAVVTINDLLEA 996
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap