Conserved Protein Domain Family
KOG0729

?
KOG0729: KOG0729 
KOG0729, 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]
Statistics
?
PSSM-Id: 228676
View PSSM: KOG0729
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
464862     1 MPPKEDWEKYKAPLEDDDKkpDDDKIVPLT-------------------EGDIQVLKSYG---------AAPYAAKLKQT 52  baker's yeast
17137738   1 MPDYLGDDQRKVK-HDEKE--D-KEIKSLD-------------------EGDIELLKTYG---------QSQYHKSIKSI 48  fruit fly
28558169   2 VRDIEDEIRDE---KNPR------PLD----------------------EDDIALLKTYG---------LGPYSAPIKKV 41  thale cress
15220933   3 IRDIMEDPENEGP-HNMRS--DFEPLLSVLrlrdyetgdiiefdsteasEEALSDITEFGsteaseahfEEPYSARIKKV 79  thale cress
2492520    1 MPDHLGDDMRKTKKDDTKE--EEKNFQALD-------------------EGDIAVLKRYG---------QGPYAEQLKTL 50  Caenorhabditis elegans
19173090   1 -------------MNGQKQ------ENIIE-------------------EKDVGFILSYG---------RNYYADGIVEK 33  Encephalitozoon cun...
547930     1 MPDYLGADQRKTK-EDEKD--D-KPIRALD-------------------EGDIALLKTYG---------QSTYSRQIKQV 48  human
24638136   1 MPPKEDWEKYQKPVDTEEE--NDKNPPPLD-------------------EGDIELLKSYA---------TGPYARELAAI 50  fission yeast
464862    53 ENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNgesdetttdnnnsgnsnsnsnqq 132 baker's yeast
17137738  49 EEDIQKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINAD----------------------- 105 fruit fly
28558169  42 EKEIKDLAKKINDLCGIKESDTGLAPPSQWDLVSDKQMMQEEQPLQVARCTKIISPN----------------------- 98  thale cress
15220933  80 EKEINELAEKICNL-GIKESDTGLAPPNQWDLVSDKQMMQEEQPLLVATCTQIISPN----------------------- 135 thale cress
2492520   51 DADIENCLKKVNELSGVKESDTGLAPPALWDIAADKQAMQQEQPLQVARCTKIITSD----------------------- 107 Caenorhabditis elegans
19173090  34 EAEIRRLFEQISLKLGTREVETGLAPPMCWDLLGDRNRIQSEPNLQVARVCKVLDG------------------------ 89  Encephalitozoon cun...
547930    49 EDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINAD----------------------- 105 human
24638136  51 KEDTEAVLKRINDTVGIKESDTGLAPISFWDVAADRQRMSEEQPLQVARCTKIIEne----------------------q 108 fission yeast
464862   133 STDADeddedakYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 212 baker's yeast
17137738 106 SDDPK-------YIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVG 178 fruit fly
28558169  99 TEDAK-------YVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVG 171 thale cress
15220933 136 TEDAK-------YVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPKIDPSVTMMTVEEKPDATYSDIG 208 thale cress
2492520  108 KHDPR-------YLINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHLPLPAKIDPTVTMMQVEEKPDVTYSDVG 180 Caenorhabditis elegans
19173090  90 YQEPR-------YMIGIKMIAKFIVGKGKRVDSSLIQEGMRVGVDRNKYQIILPLPRKIDASVTLMQVEERPDVTYHDIG 162 Encephalitozoon cun...
547930   106 SEDPK-------YIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVG 178 human
24638136 109 SAEKNa------YVINLKQIAKFVVSLGERVSPTDIEEGMRVGCDRNKYAIQLPLPPKIDPSVTMMQVEEKPDVTYGDVG 182 fission yeast
464862   213 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 292 baker's yeast
17137738 179 GCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVR 258 fruit fly
28558169 172 GCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVR 251 thale cress
15220933 209 GCKEQIEKIREVVELPMLHPEKFVRLGIDPPKGVLCYGPPGSGKTLVARAVANRTGACFIRVVGSELVQKYIGEGARMVR 288 thale cress
2492520  181 GCKDQIEKLREVVETPLLHPERYVNLGIEPPKGVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVR 260 Caenorhabditis elegans
19173090 163 GCKEEIEKIREVVEAPLLNPERFVALGIDPPKGVLLYGPPGTGKTLLARAVANRTNACFIRVIGSELVQKYVGEGARMVR 242 Encephalitozoon cun...
547930   179 GCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVR 258 human
24638136 183 GCKEQIERLREVVELPLLSPERFVKLGIDPPKGIMLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 262 fission yeast
464862   293 ELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRID 372 baker's yeast
17137738 259 ELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLD 338 fruit fly
28558169 252 ELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLD 331 thale cress
15220933 289 ELFQMARSKKACILFFDEIDAIGGARFDDGVGSDNEVQRTMLEILYQLDGFDARGNIKVLMATNRPDILDPALLRPGRLD 368 thale cress
2492520  261 ELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLD 340 Caenorhabditis elegans
19173090 243 EIFAMAKGKKACIIFFDEVDAFGGTRFDD--DDDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLD 320 Encephalitozoon cun...
547930   259 ELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLD 338 human
24638136 263 ELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVLFATNRPNTLDEALMRPGRID 342 fission yeast
464862   373 RKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS 452 baker's yeast
17137738 339 RKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIK 418 fruit fly
28558169 332 RKVEFGLPDLESRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIK 411 thale cress
15220933 369 RKVEFCLPDLEGRTQIFKIHTRTMSCERDIRFELLAGLCPNSTGADIRSVCIEAGMYAIGARRKSVTEKDFLDAVNKVVK 448 thale cress
2492520  341 RKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKVVK 420 Caenorhabditis elegans
19173090 321 RKVEFGLPDLEGRTSILRIHAKTMSVDKDIRFDLIARLCNNATGAELRSVCTEAGMFAIRERRKIATEKDFLKAVDKVVK 400 Encephalitozoon cun...
547930   339 RKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIK 418 human
24638136 343 RKVEFGLPDLEGRAHILRIHAKSMAIDKDIRWELIARLCPSQTGAELRSVCTEAGMFAIRARRRVATEKDFLDAVQKVVK 422 fission yeast
464862   453 GYKKFSSTSRYMQYN 467 baker's yeast
17137738 419 SYAKFSATPRYMTYN 433 fruit fly
28558169 412 GYQKFSATPKYMVYN 426 thale cress
15220933 449 GYQKFSATPKYMAYY 463 thale cress
2492520  421 GYAKFSATPRYLTHN 435 Caenorhabditis elegans
19173090 401 GYAKFSSTPRYLTYN 415 Encephalitozoon cuniculi
547930   419 SYAKFSATPRYMTYN 433 human
24638136 423 GNQKFSSTADYMNMS 437 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap