Conserved Protein Domain Family
KOG0483

?
KOG0483: KOG0483 
KOG0483, Transcription factor HEX, contains HOX and HALZ domains [Transcription]
Statistics
?
PSSM-Id: 228432
View PSSM: KOG0483
Aligned: 31 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3023330   84 LRGFNVNRAQSsvavvdleEEAAVVSSPNSAVSS-LSGNKrdlavarggd---eneaerascSRGGgs--gGSDDEDGg- 156 thale cress
15217910     --------------------------------------------------------------------------------     thale cress
15219881     --------------------------------------------------------------------------------     thale cress
30698765   1 -------------------malspnsssldltisipsfspspslgdhhgmrdfdinqtpkteedrewmigatphvnedds 61  thale cress
25386214   1 ------------------------------------------------------------mnRLPSse--dGDDEEFShd 18  thale cress
21264431  49 SVTVVTGA-----------DQLCRQTSSHSGVSSfSSGRVvkrerdggee---speeeemteRVISd----YHEDEEGi- 109 thale cress
1170168   57 LRKIDVNSLPTtv----dlEEETGVSSPNSTISStVSGKRrsteregtsgg-gcgddlditlDRSSsr--gTSDEEEDy- 128 thale cress
1170409   54 SYKIKTGAGAG--------DQICRQTSSHSGISSfSSGRVkrereisggd--geeeaeetteRVVCsrvsdDHDDEEGv- 122 thale cress
12230908  40 IKSYGYERRSNkrd---idDEVERSASRASNE------DN---------------------------------DDENG-- 75  thale cress
12643283  52 LRKIDVNSFPStv----ncEEDTGVSSPNSTISStISGKRseregisgtgvgsgddhdeitpDRGYsr--gTSDEEED-- 123 thale cress
3023330  157 NGD-GSRKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLT 235 thale cress
15217910   1 -----------MESNSFFFNPSASHGNIMFFFRNLNPVVQGGGTRSMMNKEETSKRRPFFSSLEDLYDDDYYDDQLLKIR 69  thale cress
15219881   1 -----------MESNSFFFNPSASHGNNMFFFRNLNPVVQGGGTRSMMNKEETSKRRPFFSSLEDPYDDDYYDDHLLKIR 69  thale cress
30698765  62 nsggrrrkklrltkeqshlleesfiqnhtltpkqkkdlatflklsqrqvevwfqnrrarsklkhteMECEYLKRWFGSLK 141 thale cress
25386214  19 DGSaPPRKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLT 98  thale cress
21264431 110 ----SARKKLRLTKQQSALLEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLA 185 thale cress
1170168  129 -GGeTCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLT 207 thale cress
1170409  123 ----SARKKLRLTKQQSALLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLT 198 thale cress
12230908  76 ----STRKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLT 151 thale cress
12643283 124 -GGeTSRKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLT 202 thale cress
3023330  236 EENRRLQKEVSELRALKLSPHLYMHMTPPTTLTMCPSCERVSSSAATVTAAp--STTTTPTVVGRPSPQ-RLTPWT 308 thale cress
15217910  70 GC-------------------------------------------------------------------------- 71  thale cress
15219881  70 GC-------------------------------------------------------------------------- 71  thale cress
30698765 142 EQNRRLQIEVEELRALKP--------SSTSALTMCPRCERVTDAVDNDS-----NAVQEGAVLSSRSRMtISSSSS 204 thale cress
25386214  99 EENHRLHREVEELRAMKVG---PTTVNSASSLTMCPRCERVTPAAS-----------PSRAVVPVPAKKtFPPQER 160 thale cress
21264431 186 DENIRLQKEIQELKTLKLTQPFYMHM-PASTLTKCPSCERIGGGGGGNGGGgggSGATAVIVDGSTAKGaFSISSK 260 thale cress
1170168  208 EENRRLEKEAAELRALKLSPRLYGQMSPPTTLLMCPSCERVAGPSSSN-------HNQRSVSLSPWL----QMAHG 272 thale cress
1170409  199 DENRRLQKELQDLKALKLSQPFYMHM-PAATLTMCPSCERLGGGG---------VGGDTTAVDEETAKGaFSIVTK 264 thale cress
12230908 152 EENRRLQKEVKELRTLKTSTPFYMQL-PATTLTMCPSCERVATSAAQPSTS---AAHNLCLSTSSLIPVkPRPAKQ 223 thale cress
12643283 203 EENRRLQKEAMELRTLKLSPQFYGQMTPPTTLIMCPSCERVGGPSSSNH-----HHNHRPVSINPWVACaGQVAHG 273 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap