Conserved Protein Domain Family
KOG0460

?
KOG0460: KOG0460 
KOG0460, Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 228409
View PSSM: KOG0460
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17556456   2 QILNLLSRNVGVFKtVTLCEQKMQQVS---------------------LMQAR----HLAVPGG---------------K 41  Caenorhabditis elegans
7303306    4 AFAAAVCRSTASMSlALRCSRRAMSSArmlrma----------gatatSTACKdwqrNGLLAAPrtgnmqqylreyaneK 73  fruit fly
7304205    1 -MSGLLPKLWRQCEaGLVRRISQALIGp-------------------gASQSRwtgtRLLATSAdk------------nP 48  fruit fly
25090254   5 VLRNPSSKRLVPFS-SQIYSRCGASVTssysis----------hsiggDDLSSstfgTSSFWRS---------------M 58  thale cress
119194     7 AACSSSSRILCSYS-SPSPSLCPAISTsgklktltlsssflpsyslttTSASQstrrSFTVRAA---------------R 70  thale cress
25299408   1 ----MNPAALSAFTrSLLFNRCSTSSFc--------------------NSITR----NAVAFFA---------------- 36  Caenorhabditis elegans
1706611    1 maAATLLRATPHFS-GLAAGRTFLLQGllrll-----------kapalPLLCR-----GLAVEA---------------K 48  human
1706611    1 maAATLLRATPHFS-GLAAGRTFLLQGllrll-----------kapalPLLCR-----GLAVEA---------------K 48  human
11386758   1 MNSAKATSLLFQGF-RKNCLRLNRISFa--------------------SGLINrftvPARTYAD---------------E 44  fission yeast
119216     1 -MSALLPRLLTRTA-FKASGKLLRLS----------------------SVISRtfsqTTTSYA----------------- 39  baker's yeast
17556456  42 AVFKRDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDCP 121 Caenorhabditis elegans
7303306   74 KVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCP 153 fruit fly
7304205   49 APGLRELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCP 128 fruit fly
25090254  59 ATFTRNKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAKAIAFDEIDKAPEEKKRGITIATAHVEYETAKRHYAHVDCP 138 thale cress
119194    71 GKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEIDAAPEERARGITINTATVEYETENRHYAHVDCP 150 thale cress
25299408  37 TAAATPKINVNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINVAHIGYESPLRRYSHTDCP 116 Caenorhabditis elegans
1706611   49 KTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCP 128 human
1706611   49 KTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCP 128 human
11386758  45 KVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCP 124 fission yeast
119216    40 AAFDRSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCP 119 baker's yeast
17556456 122 GHADYIKNMITGAAQMEGAILVVAATDGPMPQTREHLLLARQVGVplDNIVVFMNKVDEVPDAETRELVEMDIREQLNEF 201 Caenorhabditis elegans
7303306  154 GHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGI--DHIVVFINKVDAA-DEEMVDLVEMEIRELLTEM 230 fruit fly
7304205  129 GHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGI--QRIIVFINKADLV-DQEVLELVEIEMREMLSDF 205 fruit fly
25090254 139 GHADYVKNMITGAAQMDGGILVVSGPDGPMPQTKEHILLARQVGV--PSLVCFLNKVDVVDDPELLELVEMELRELLSFY 216 thale cress
119194   151 GHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGV--PDMVVFLNKEDQVDDAELLELVELEVRELLSSY 228 thale cress
25299408 117 GHSDFIKNMICGTSQMDVAVLVIAATDGVMEQTKEHLILAKQVGV--KNMAIFINKADLV-EEDDLDLVEMEARELLSLH 193 Caenorhabditis elegans
1706611  129 GHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGV--EHVVVYVNKADAVQDSEMVELVELEIRELLTEF 206 human
1706611  129 GHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGV--EHVVVYVNKADAVQDSEMVELVELEIRELLTEF 206 human
11386758 125 GHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGV--KQIVVYINKVDMV-EPDMIELVEMEMRELLSEY 201 fission yeast
119216   120 GHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGV--QHIVVFVNKVDTIDDPEMLELVEMEMRELLNEY 197 baker's yeast
17556456 202 GYPGDTCPVIFGSALCALEG--KQPEIGE------EAVKQLLEVLDNKFVIPERKVNEEPMFAAEHVYSIVGRGTVITGK 273 Caenorhabditis elegans
7303306  231 GYDGDKIPVVKGSALCALED--KSPEIGK------EAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGR 302 fruit fly
7304205  206 GFDGVNSPVICGSALLALRE--DKSEFGV------PSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGT 277 fruit fly
25090254 217 KFPGDDIPIIRGSALSALQGt--NDEIGR------QAILKLMDAVDEYIPDPVRVLDKPFLMPIEDVFSIQGRGTVATGR 288 thale cress
119194   229 EFNGDDIPIISGSALLAVETltENPKVKRgdnkwvDKIYELMDAVDDYIPIPQRQTELPFLLAVEDVFSITGRGTVATGR 308 thale cress
25299408 194 GFNGDATPVIRGSALSALEG----QDISC--------IERLIDALDS-LPEPDRNEKDTFVMPIASKTAITGRGTVIVGT 260 Caenorhabditis elegans
1706611  207 GYKGEETPVIVGSALCALEG--RDPELGL------KSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGT 278 human
1706611  207 GYKGEETPVIVGSALCALEG--RDPELGL------KSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGT 278 human
11386758 202 GFDGDNTPIVSGSALCALEG--REPEIGL------NSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGR 273 fission yeast
119216   198 GFDGDNAPIIMGSALCALEG--RQPEIGE------QAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVTGR 269 baker's yeast
17556456 274 LERGILKRGDKIEIVGGTKDgttVKSVISGLESFRKTVDQAEPGDQLGVLLRGLGPKDVRRGCVLLPQGHkHKVTDKVKA 353 Caenorhabditis elegans
7303306  303 LERGVVKKGMECEFVGYNKV---LKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGS-VKALDQLEA 378 fruit fly
7304205  278 IKRGTIPRNADADLLGFNQN---LKTSISDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGS-EDISNHFEG 353 fruit fly
25090254 289 IEQGVIKVGEEVEILGLREGgvpLKSTVTGVEMFKKILDNGQAGDNVGLLLRGLKREDIQRGMVIAKPGS-CKTYKKFEA 367 thale cress
119194   309 VERGTVKVGETVDLVGLRET---RSYTVTGVEMFQKILDEALAGDNVGLLLRGIQKADIQRGMVLAKPGS-ITPHTKFEA 384 thale cress
25299408 261 LERGVLKKGDKVEIKGDGQT---LQTTASDIQVFGKSVKEVRAGDHCGVLCRGVKGDTVKRGMWAGHPGA-VTITNRVKV 336 Caenorhabditis elegans
1706611  279 LERGILKKGDECELLGHSKN---IRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGS-IKPHQKVEA 354 human
1706611  279 LERGILKKGDECELLGHSKN---IRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGS-IKPHQKVEA 354 human
11386758 274 VERGTLKKGAEIEIVGYGSh---LKTTVTGIEMFKKQLDAAVAGDNCGLLLRSIKREQLKRGMIVAQPGT-VAPHQKFKA 349 fission yeast
119216   270 VERGNLKKGEELEIVGHNSTp--LKTTVTGIEMFRKELDSAMAGDNAGVLLRGIRRDQLKRGMVLAKPGT-VKAHTKILA 346 baker's yeast
17556456 354 QLYVLKESEGGAKTPIANYFSEHVFSLTWDSGASVRIIG------KDFVMPGESAEVELSLNSQMFIEPQQRFTIRKGAK 427 Caenorhabditis elegans
7303306  379 QVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPd------KEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNL 452 fruit fly
7304205  354 SMYLLSRAEGGRVKPMLSKYIQQLFSQTWNVPARIDIVPs-----EAMLMPGEHGQVRVTLLRKMVMTPGQAFTIRENGA 428 fruit fly
25090254 368 EIYVLTKDEGGRHTAFFSNYRPQFYLRTADITGKVelp-----enVKMVMPGDNVTAVFELIMPVPLETGQRFALREGGR 442 thale cress
119194   385 IIYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTKIMndkdeeSKMVMPGDRVKIVVELIVPVACEQGMRFAIREGGK 464 thale cress
25299408 337 ELYLLSEAENGRKIGIRTGFTDKMYCSTWDQVGRFDMS-------NELLMPGEHTSATVLLMKDMPLRKGMPFTLREGSS 409 Caenorhabditis elegans
1706611  355 QVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPe-----KELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNR 429 human
1706611  355 QVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPe-----KELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNR 429 human
11386758 350 SFYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVELTHPdpn--dsDKMVMPGDNVEMICTLIHPIVIEKGQRFTVREGGS 427 fission yeast
119216   347 SLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVMRFPKeve-dhSMQVMPGDNVEMECDLIHPTPLEVGQRFNIREGGR 425 baker's yeast
17556456 428 --TIGTGVFTDVLPpLTNDEKDpKSKK 452 Caenorhabditis elegans
7303306  453 --TLGTGVVTSTLPpLTESQRSeLTEG 477 fruit fly
7304205  429 --TVATGMVTQRLPsLDLPKNKlSKVF 453 fruit fly
25090254 443 --TVGAGVVSKVMT------------- 454 thale cress
119194   465 --TVGAGVIGTILE------------- 476 thale cress
25299408 410 ktTIARGIISDLEDhVAFKMSGrVDEQ 436 Caenorhabditis elegans
1706611  430 --TIGTGLVTNTLA-MTEEEKN-IKWG 452 human
1706611  430 --TIGTGLVTNTLA-MTEEEKN-IKWG 452 human
11386758 428 --TVGTALVTELLD------------- 439 fission yeast
119216   426 --TVGTGLITRIIE------------- 437 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap