Conserved Protein Domain Family
KOG0394

?
KOG0394: KOG0394 
KOG0394, Ras-related GTPase [General function prediction only]
Statistics
?
PSSM-Id: 228343
View PSSM: KOG0394
Aligned: 17 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7298580    4 MRPPQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRALRTPFYR 83
gi 7301083    1 MSG-RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYR 79
gi 15218194   1 MSSRR-RVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQIWDTAGQERFQSLGVAFYR 79
gi 15233284   1 MASRR-RVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQIWDTAGQERFQSLGVAFYR 79
gi 15230211   1 MPSRR-RTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYR 79
gi 17536699   1 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQIWDTAGQERFQSLGVAFYR 80
gi 1710003    1 --MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYR 78
gi 13124471   1 --MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYR 78
gi 19114436   1 MSA-QKRVFLKVVILGDSGVGKTCLMNQFVNQKFSREYKATIGADFLTKDVVVDDKLVTLQLWDTAGQERFQSLGMAFYR 79
gi 12230853   1 MAG-KKKHLLKVIILGESGVGKTSIMNQYVNRKFSKDYKATIGADFLTKEVLVDDKVVTLQLWDTAGQERFQSLGVAFYR 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7298580   84 GSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQ-DKFPFIVVGNKNDIPA-QKRQVSSDAVQQWCAEQK--VACHIET 159
gi 7301083   80 GADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDpDHFPFVVLGNKVDLDN---RQVSTRRAQQWCQSKN--DIPYYET 154
gi 15218194  80 GADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDpENFPFVVLGNKTDVDGgKSRVVSEKKAKAWCASKG--NIPYFET 157
gi 15233284  80 GADCCVLVNDVNVMKSFENLNNWREEFLIQASPSDpENFPFVVLGNKTDVDGgKSRVVTEKKAKSWCASKG--NIPYFET 157
gi 15230211  80 GADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDpENFPFVLIGNKVDVDDgNSRVVSEKKAKAWCASKG--NIPYFET 157
gi 17536699  81 GADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDpDHFPFVLLGNKVDLESq--RAVSSKRAQSWCQTKG--NIPYYEV 156
gi 1710003   79 GSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEpESFPFVILGNKIDI---SERQVSTEEAQAWCRDNG--DYPYFET 153
gi 13124471  79 GADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDpEHFPFVVLGNKVDK---EDRQVTTEEAQTWCMENG--DYPYLET 153
gi 19114436  80 GADCCVIVYNVNNSKSFDSVENWRQEFLYQTS-QDeCAFPFIIVGNQIDKDAsK-RAVSLHRALDYCKSKHgsNMIHFEA 157
gi 12230853  80 GADCCVLVYDVNNSKSFETLDSWRDEFLIQASPSNpETFPFILLGNKVDVEEqK-RMVSKSKALAFCQARG--EIPYFET 156
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*
gi 7298580  160 SSKAATNVTDAFVLGLRQWRHMECV-AEAELRQHGDTIDLTRPIRLVQRriCCTG 213
gi 7301083  155 SAKEGINVEMAFQVIAKNALELEA--EAEVINDFPDQITLGSQNNRPGNpdNCQC 207
gi 15218194 158 SAKEGFNVDAAFECITKNAFKNEPEeEP-----YLPDTIDVAGGQQQRSt-GCEC 206
gi 15233284 158 SAKDGVNVDAAFECIAKNALKNEPEeEV-----YLPDTIDVAGARQQRSt-GCEC 206
gi 15230211 158 SAKVGTNVEEAFQCIAKDALKSGEEeEL-----YLPDTIDVGTSNQQRSt-GCEC 206
gi 17536699 157 SAKEALNVEAAFLAIARDALARESQ-ETNDFPEFPDQIRLNPNQQNQQNs-GCNC 209
gi 1710003  154 SAKDATNVAAAFEEAVRRVLATE---DRSDHLIQTDTVNLHRKPKPSSS--CC-- 201
gi 13124471 154 SAKDDTNVTVAFEEAVRQVLAVE---EQLEHCMLGHTIDLNSGSKAGSS--CC-- 201
gi 19114436 158 SAKENTNVTDLFETVSRLALENESSr-DDFVNDFSEPLLLSKPLNNTSS---CNC 208
gi 12230853 157 SAKEAINVQEAFETVAKLALENMDS--DDIAADFTDPIHLDMESQKTS----CYC 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap