Conserved Protein Domain Family
KOG0205

?
KOG0205: KOG0205 
KOG0205, Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 228154
View PSSM: KOG0205
Aligned: 16 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12230460    1 MTD--IEa---LKAITTESID-----LENVPVEEVFQHLKCTKE--GLTSNEVQERLTLFGYNKLE-EKKESKILKFLGF 67   thale cress
12585313    1 MAEdlDKplldPDTFNRKGID-----LGILPLEEVFEYLRTSPQ--GLLSGDAEERLKIFGPNRLE-EKQENRFVKFLGF 72   thale cress
12230478    1 MAA--DIs---WDEIKKENVD-----LEKIPVDEVFQQLKCSRE--GLSSEEGRNRLQIFGANKLE-EKVENKFLKFLGF 67   thale cress
12230479    1 -------------mseldhiknesvdlvripMEEVFEELKCTKQ--GLTANEASHRLDVFGPNKLE-EKKESKLLKFLGF 64   thale cress
12230461    1 MAT--EFs---WDEIKKENVD-----LERIPVEEVFEQLKCSKE--GLSSDEGAKRLEIFGANKLE-EKSENKFLKFLGF 67   thale cress
12230481    4 TVEdnREv---LEAVLKEAVD-----LENVPIEEVFENLRCSKE--GLTTQAADERLALFGHNKLE-EKKESKFLKFLGF 72   thale cress
12230483    1 MATg-DS----LEDIKIEIDDd----LEKIPIEEVFKKLRCSRE--GLSGAEGKERLKIFGPNKLEnKKKEHITLRFFAL 69   thale cress
12230459    1 -MGdkEEv---LEAVLKETVD-----LENVPIEEVFESLRCSRE--GLTTEAADERLALFGHNKLE-EKKESKFLKFLGF 68   thale cress
114333     45 LIEelFS-----EDVQEEQEDnd-daPAAGEAKAVPEELLQTDMntGLTMSEVEERRKKYGLNQMK-EELENPFLKFIMF 117  fission yeast
114337    132 LIEdlYS-----QDQEEEQVEeeespGPAGAAKVVPEELLETDPkyGLTESEVEERKKKYGLNQMK-EEKTNNIKKFLSF 205  fission yeast
12230460   68 MWNPLSWVMEAAALMAIGLAHGGGKPADYHDFVGIVVLLLINSTISFVEENNAGNAAAALMAQLAPKAKAVRDGKWNEID 147  thale cress
12585313   73 MWNPLSWVMEAAALMAIALANSQSLGPDWEDFTGIVCLLLINATISFFEENNAGNAAAALMARLALKTRVLRDGQWQEQD 152  thale cress
12230478   68 MWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNAAAALMANLAPKTKVLRDGRWGEQE 147  thale cress
12230479   65 MWNPLSWVMEVAALMAIALANGGGRPPDWQDFVGIVCLLLINSTISFIEENNAGNAAAALMAGLAPKTKVLRDNQWSEQE 144  thale cress
12230461   68 MWNPLSWVMESAAIMAIVLANGGGKAPDWQDFIGIMVLLIINSTISFIEENNAGNAAAALMANLAPKTKVLRDGKWGEQE 147  thale cress
12230481   73 MWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD 152  thale cress
12230483   70 MFKPLSWVIQAAAIMAMLFANGDGR----QLFLGIVCLLIVNTIICYLKEDDAANVVAMARAGLSPKTKVLRDGKWSEQE 145  thale cress
12230459   69 MWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD 148  thale cress
114333    118 FVGPIQFVMEMAAALAAGLR-------DWVDFGVICALLMLNAVVGFVQEYQAGSIVDELKKSLALKAVVIREGQVHELE 190  fission yeast
114337    206 FVGPIQFVMELAAALAAGLR-------DWVDFGVICALLLLNATVGFVQEYQAGSIVDELKKTMALKASVLRDGRVKEIE 278  fission yeast
12230460  148 AAELVPGDIVSIKLGDIIPADARLLEGD-PLKIDQATLTGESLPVTKNPGASVYSGSTCKQGEIEAVVIATGVHTFFGKA 226  thale cress
12585313  153 ASILVPGDIISIKLGDIIPADARLLEGD-PLKIDQSVLTGESLPVTKKKGEQVFSGSTCKQGEIEAVVIATGSTTFFGKT 231  thale cress
12230478  148 AAILVPGDLISIKLGDIVPADARLLEGD-PLKIDQSALTGESLPATKHQGDEVFSGSTCKQGEIEAVVIATGVHTFFGKA 226  thale cress
12230479  145 ASILVPGDVISIKLGDIIPADARLLDGD-PLKIDQSSLTGESIPVTKNPSDEVFSGSICKQGEIEAIVIATGVHTFFGKA 223  thale cress
12230461  148 ASILVPGDLISIKLGDIVPADARLLEGD-PLKIDQSALTGESLPTTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKA 226  thale cress
12230481  153 AAILVPGDIISIKLGDIVPADARLLEGD-PLKIDQSALTGESLPVTKSSGDGVYSGSTCKQGEIEAVVIATGVHTFFGKA 231  thale cress
12230483  146 ASILVPGDIVSIKPGDIIPCDARLLEGD-TLKVDQSALTGEFGPITKGPGEEVFSGTTCKQGEMEAVVIATGVHTFSGTT 224  thale cress
12230459  149 AAILVPGDIISIKLGDIVPADARLLEGD-PLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQGELEAVVIATGVHTFFGKA 227  thale cress
114333    191 ANEVVPGDILKLDEGTIICADGRVVTPDvHLQVDQSAITGESLAVDKHYGDPTFASSGVKRGEGLMVVTATGDSTFVGRA 270  fission yeast
114337    279 ASEIVPGDILHLDEGTICPADGRLITKDcFLQVDQSAITGESLAVDKHQNDTMYSSSTVKRGEAFMVVTATADSTFVGRA 358  fission yeast
12230460  227 AHLVDS-TTHVGHFQKVLTAIGNFCICSIAVGMAIEIVVIYGLQKRGYRVGIDNLLVLLIGGIPIAMPTVLSVTMAIGAH 305  thale cress
12585313  232 ARLVDS-TDVTGHFQQVLTSIGNFCICSIAVGMVLEIIIMFPVQHRSYRIGINNLLVLLIGGIPIAMPTVLSVTLAIGSH 310  thale cress
12230478  227 AHLVDS-TNNVGHFQKVLTAIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH 305  thale cress
12230479  224 AHLVDN-TNQIGHFQKVLTSIGNFCICSIALGIIVELLVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPSVLSVTMATGSH 302  thale cress
12230461  227 AHLVDS-TNNVGHFQKVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH 305  thale cress
12230481  232 AHLVDT-TNQIGHFQQVLTAIGNFCICSIAVGMLIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH 310  thale cress
12230483  225 AHLVDNrTNKVGHFRKVVTEIENLCVISIAIGISIEVIVMYWIQRRNFSDVINNLLVLVIGGIPLAMPTVLYVIMVTGSL 304  thale cress
12230459  228 AHLVDT-TNHVGHFQQVLTAIGNFCICSIAVGMIIEIVVMYPIQHRAYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH 306  thale cress
114333    271 ASLVNAaAGGTGHFTEVLNGIGTILLVLVLLTLFCIYTAAFYRSVRLARLLEYTLAITIIG-VPVGLPAVVTTTMAVGAA 349  fission yeast
114337    359 ASLVGAaGQSQGHFTEVLNGIGTILLVLVILTLLCIYTAAFYRSVRLAALLEYTLAITIIG-VPVGLPAVVTTTMAVGAA 437  fission yeast
12230460  306 RLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFKRGIDRDMAVLMAARAA--RLENQDAIDTAIVS 383  thale cress
12585313  311 RLSQQGAITKRMTAIEEMAGMDVLCCDKTGTLTLNSLTVDKNLIEVFVDYMDKDTILLLAGRAS--RLENQDAIDAAIVS 388  thale cress
12230478  306 RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSKDVDKDYVILLSARAS--RVENQDAIDTSIVN 383  thale cress
12230479  303 RLFQQGAITKRMTAIEEMAGMDVLCCDKTGTLTLNKLTVDKNLVEVFAKGVGKEHVFLLAARAS--RIENQDAIDAAIVG 380  thale cress
12230461  306 RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDSDSVVLMAARAS--RIENQDAIDASIVG 383  thale cress
12230481  311 RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFMKGVDADTVVLMAARAS--RLENQDAIDAAIVG 388  thale cress
12230483  305 RLYRTGTITQRITAIEDMAAIDVLCSDKTGTLTLNKLSVDKNLIKVYSKDVEKEQVLLLAARAS--RIENRDGIDAAMVG 382  thale cress
12230459  307 RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFTKGVDADTVVLMAAQAS--RLENQDAIDAAIVG 384  thale cress
114333    350 YLAEKQAIVQKLSAIESLAGVEVLCSDKTGTLTKNKLSLGE--P-FTVSGVSGDDLVLTACLAAsrKRKGLDAIDKAFLK 426  fission yeast
114337    438 YLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNRLSLGE--P-YCVEGVSPDDLMLTACLASsrKKKGLDAIDKAFLK 514  fission yeast
12230460  384 MLSD-P--KEARAGIKELHFLPFSPANRRTALTYLDGEGKMHRVSKGAPEEILDMAHNKLEIKEKVHATID----KFAER 456  thale cress
12585313  389 MLAD-P--REARANIREIHFLPFNPVDKRTAITYIDSDGKWYRATKGAPEQVLNLCQQKNEIAQRVYAIID----RFAEK 461  thale cress
12230478  384 MLGD-P--KEARAGITEVHFLPFNPVEKRTAITYIDTNGEWHRCSKGAPEQIIELCDLKGETKRRAHEIID----KFAER 456  thale cress
12230479  381 MLAD-P--KEARAGVREVHFFPFNPVDKRTALTYVDSDGNWHRASKGAPEQILNLCNCKEDVRRKVHGVID----KFAER 453  thale cress
12230461  384 MLGD-P--KEARAGITEVHFLPFNPVDKRTAITYIDESGDWHRSSKGAPEQIIELCNLQGETKRKAHEVID----GFAER 456  thale cress
12230481  389 MLAD-P--KDARAGIQEVHFLPFNPTDKRTALTYIDNEGNTHRVSKGAPEQILNLAHNKSEIERRVHAVID----KFAER 461  thale cress
12230483  383 SLAD-P--KEARAGIREVH---FNLVDKRTALTYIDGNGDWHRVSKGTPEQILDLCNARDDLRKSVHSAIR----NYAER 452  thale cress
12230459  385 MLAD-P--KEARAGVREVHFLPFNPTDKRTALTYIDSDGKMHRVSKGAPEQILNLAHNRAEIERRVHAVID----KFAER 457  thale cress
114333    427 ALKNyPgpRSMLTKYKVIEFQPFDPVSKKVTAYVQAPDGTRITCVKGAPLWVLKTVEEDHPIPEDVLSAYKdkvgDLASR 506  fission yeast
114337    515 ALRNyPkaKDQLSKYKVLDFHPFDPVSKKITAYVEAPDGQRITCVKGAPLWVFKTVQDDhevpeaitdayreqvndmasr 594  fission yeast
12230460  457 GLRSLGLAYQEVPDGDVKGEGGPWDFVALLPLFDPPRHDSAQTIERALHLGVSVKMITGDQLAIAKETGRRLGMGTNMYP 536  thale cress
12585313  462 GLRSLAVAYQEIPEKSNNSPGGPWRFCGLLPLFDPPRHDSGETILRALSLGVCVKMITGDQLAIAKETGRRLGMGTNMYP 541  thale cress
12230478  457 GLRSLGVARQRVPEKDKESAGTPWEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYP 536  thale cress
12230479  454 GLRSLAVARQEVLEKKKDAPGGPWQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYP 533  thale cress
12230461  457 GLRSLGVAQQTVPEKTKESDGSPWEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYP 536  thale cress
12230481  462 GLRSLAVAYQDVPEGRKDSAGGPWQFVGLMPLFDPPRHDSAETIRRALNLGVSVKMITGDQLAIGKETGRRLGMGTNMYP 541  thale cress
12230483  453 GLKSFAIS---------------W-------F----RNTNCNTVF--------------------------------FFP 474  thale cress
12230459  458 GLRSLAVAYQEVPEGTKESAGGPWQFMGLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYP 537  thale cress
114333    507 GYRSLGVARKI--------EGQHWEIMGIMPCSDPPRHDTARTISEAKRLGLRVKMLTGDAVDIAKETARQLGMGTNIYN 578  fission yeast
114337    595 gfrslgvarkadgkqweilgimpcsdpprhdtartiheaiglglrikmltgdavgiaketarqlgmgtnvynaerlglsg 674  fission yeast
12230460  537 SSSLLSD---NNTEGVSVDELIENADGFAGVFPEHKYEIVKRLQSRKHICGMTGDGVNDAPALKKADIGIAVDDATDAAR 613  thale cress
12585313  542 SSSLLGHn-nDEHEAIPVDELIEMADGFAGVFPEHKYEIVKILQEMKHVVGMTGDGVNDAPALKKADIGIAVADATDAAR 620  thale cress
12230478  537 SSSLLENk-dDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADIGIAVDDATDAAR 615  thale cress
12230479  534 SSALLGQvkdSSLGALPVDELIEKADGFAGVFPEHKYEIVHRLQQRNHICGMTGDGVNDAPALKKADIGIAVVDATDAAR 613  thale cress
12230461  537 STSLLGNskdESLVGIPIDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAAR 616  thale cress
12230481  542 SSALLGQnkdESIVALPVDELIEKADGFAGFSAEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAAR 621  thale cress
12230483  475 ----Y--------------QLCS----------EHKYHIVNKLQER-HICGLIGDGVDDVPSLKKADVGIAVANATEAAR 525  thale cress
12230459  538 SSALLGQhkdESIGALPIDDLIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAAR 617  thale cress
114333    579 -AERLGLtggGNMPGSEVYDFVEAADGFGEVFPQHKYAVVDILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAAR 657  fission yeast
114337    675 ggdmpgsevndfveaadgfaevfpqhkyavvdilqqrgylvamtgdgvndapslkkadagiavegasdaarsaadivfla 754  fission yeast
12230460  614 GASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV-MGFMLLCVFWEFDFPPFMVLVIAILNDGTIMTISK 692  thale cress
12585313  621 SSADIVLTDPGLSVIISAVLTSRAIFQRMRNYTVYAVSITIR-IvLGFTLLALIWEYDFPPFMVLIIAILNDGTIMTISK 699  thale cress
12230478  616 SASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV-LGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISK 694  thale cress
12230479  614 GASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV-FGFMFIALIWQFDFSPFMVLIIAILNDGTIMTISK 692  thale cress
12230461  617 SASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV-LGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISK 695  thale cress
12230481  622 SASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV-LGFMLLALIWQFDFPPFMVLIIAILNDGTIMTISK 700  thale cress
12230483  526 AASDIVLTEPGLSVIIDAVLASRAILQQMKHYTIYAVSITIRVV-FGFMFIALIWKFDFSPFMVLAIALLNEETTKAITM 604  thale cress
12230459  618 SASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV-LGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISK 696  thale cress
114333    658 SAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLE-IFLGLWLIIRNQLLNLELVVFIAIFADVATLAIAY 736  fission yeast
114337    755 pglsaiidalktsrqifhrmyayvvyrialslhleiflglwliirnqllnlelivfiaifadvatlaiaydnapyamkpv 834  fission yeast
12230460  693 DRVK-PSPTPDCWKLKEIFATGVVLGAYLAIMTVVFFWAAYETNFFH-NIFHVRNFNQHHFKmkdkkvaahlneqMASAV 770  thale cress
12585313  700 DRVR-PSPTPESWKLNQIFATGIVIGTYLALVTVLFYWIIVSTTFFE-KHFHVKSIANNSEQ-------------VSSAM 764  thale cress
12230478  695 DRVK-PSPIPDSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFS-DKFGVRSLQGKDEE-------------LIAVL 759  thale cress
12230479  693 DRMK-PSPQPDSWKLRDIFSTGVVLGGYQALMTVVFFWVMKDSDFFS-NYFGVRPLSQRPEQ-------------MMAAL 757  thale cress
12230461  696 DRVK-PSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFS-KTFGVRSIQGNEEE-------------LMAAL 760  thale cress
12230481  701 DRVK-PSPLPDSWKLSEIFATGVVFGSYMAMMTVIFFWVSYKTDFFP-RTFGVATLEKTAHDdf---------rkLASAI 769  thale cress
12230483  605 DNVTnPSPTPDSLKLKEIFATGVVYGSYMALITVVFFWAAYRTDIFP-RTFHVRDLRGNEAE-------------MMCAL 670  thale cress
12230459  697 DRVK-PSPLPDSWKLSEIFATGVVFGSYMAMMTVIFFWAAYKTDFFP-RTFGVSTLEKTAHDdf---------rkLASAI 765  thale cress
114333    737 DNAP-YSMKPVKWNLPRLWGLSTVIG----IVLAIGTWITNTTMIAQgQNRGIVQNFGVQDE-------------VL--- 795  fission yeast
114337    835 kwnlprlwglativgillaigtwivnttmiaqgqnrgivqnfgvqdevlflqisltenwlifitrcsgpfwssfpswqls 914  fission yeast
12230460  771 YLQVSTISQALIFVTRSRSWSFVERPGFLLVIAFLIAQLVASVISAMANWPFAGIRSIGWGWTGVIWIFNIVTYMLLDPI 850  thale cress
12585313  765 YLQVSIISQALIFVTRSRGWSFFERPGTLLIFAFILAQLAATLIAVYANISFAKITGIGWRWAGVIWLYSLIFYIPLDVI 844  thale cress
12230478  760 YLQVSIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDIL 839  thale cress
12230479  758 YLQVSIISQALIFVTRSRSWSYAECPGLLLLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLL 837  thale cress
12230461  761 YLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAVYANWGFARIVGCGWGWAGGIWVYSIITYIPLDIL 840  thale cress
12230481  770 YLQVSIISQALIFVTRSRSWSFVERPGIFLMIAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFI 849  thale cress
12230483  671 YLQVSIMSQALFFVIQSRSWFFVERPGELLFLSFVTVQTIATTLAVYASWETARIEGIGWSWAGVIWLYNIIFFFPLDIM 750  thale cress
12230459  766 YLQVSIISQALIFVTRSRSWSYVERPGMLLVVAFILAQLVATLIAVYANWSFAAIEGIGWGWAGVIWLYNIVFYIPLDII 845  thale cress
114333    796 FLEISLTENWLIFVTRCNGPFWSSIPSWQLSGAVLAVDILATMFCIFGWFKGGHQTSIVAVLR--IWMYSFGIFCIMAGT 873  fission yeast
114337    915 gavlvvdilatlfcifgwfkgghqtsivaviriwmysfgifcliagvyyilsesssfdrwmhgkhkergttrkledfvmq 994  fission yeast
12230460  851 KFLVRYALSGKSWDRMVEGRTALTGKKNFGQEERMAAWATEKRTQHGLETGQkpv--yerNsaTELNNMAEEAKRRAEIA 928  thale cress
12585313  845 KFVFHYALSGEAWNLVLDRKTAFTYKKDYGKDDGSPNVTISQRSRSAEELRG--------Sr-SRASWIAEQTRRRAEIA 915  thale cress
12230478  840 KFITRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPPEsmf--edtAtyTELSEIAEQAKKRAEVA 917  thale cress
12230479  838 KFGIRYVLSGKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEknnifnekNsySELSQIAEQAKRRAEVV 917  thale cress
12230461  841 KFIIRYALTGKAWDNMINQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPPEamf--ndnK--NELSEIAEQAKRRAEVA 916  thale cress
12230481  850 KFFIRYALSGRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDtkmf-tdrThvSELNQMAEEAKRRAEIA 928  thale cress
12230483  751 KFGIRYILTGKAQS-LFDNMVHLVLN-SYAK--LS----------NGIYNHT----------------QADHTYSLLEVS 800  thale cress
12230459  846 KFLIRYALSGRAWDLVIEQRVAFTRQKDFGKEQRELQWAHAQRTLHGLQAPDakmf-perThfNELSQMAEEAKRRAEIA 924  thale cress
114333    874 YYILS--ES-AGFDRMMNGKP-KESRNQRSIEDLVV----------ALQRTS----------------TRHEKG-DA--- 919  fission yeast
114337    995 lqrtsthheaegkvts---------------------------------------------------------------- 1010 fission yeast
12230460  929 RMRELQTLKGKVESAAKLKGYDLEDPnsNNYTI 961  thale cress
12585313  916 RLLEVHSVSRHLESVIKLKQIDQRMIr-AAHTV 947  thale cress
12230478  918 RLREVHTLKGHVESVVKLKGLDIDNLn-QHYTV 949  thale cress
12230479  918 RLREINTLKGHVESVVKLKGLDIDTIq-QHYTV 949  thale cress
12230461  917 RLRELHTLKGHVESVVKLKGLDIDTIq-QHYTV 948  thale cress
12230481  929 RLRELHTLKGHVESVVRLKGLDIETIq-QAYTV 960  thale cress
12230483  801 -TPPSQDLRG-VGWV------------------ 813  thale cress
12230459  925 RLRELHTLKGHVESVVRLKGLDIETIq-QAYTV 956  thale cress
114333        ---------------------------------      fission yeast
114337        ---------------------------------      fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap