Conserved Protein Domain Family
KOG0080

?
KOG0080: KOG0080 
KOG0080, GTPase Rab18, small G protein superfamily [General function prediction only]
Statistics
?
PSSM-Id: 228031
View PSSM: KOG0080
Aligned: 5 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 20-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
25151655   1 MSDDS--SSPLTTLKILIIGESGVGKSSLMLRFVDDVFDPEQAATIGVDFRVTSMAIDGNRVKLAIWDTAGQERFRTLTP 78  Caenorhabditis elegans
7290608    1 MADR------A--IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSLTP 72  fruit fly
15218575   1 MGSSSgqPEFDYLFKVLLIGDSGVGKSSLLLSFTSNTFDDLSPT-IGVDFKVKYLTIGEKKLKLAIWDTAGQERFRTLTS 79  thale cress
15232785   1 MGSSSgqSGYDLSFKILLIGDSGVGKSSLLLSFISSSVEDLAPT-IGVDFKIKQMKVRGKRLKLTIWDTAGQEKFRTLTS 79  thale cress
12230528   1 MDED-----VLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTP 75  human
25151655  79 SYYRGAQGVICVYDVTSRSSFEKL-NHWMQEVDTYCTNDNIIKMMVANKIDmvrksrfcsifglKNNfqpNRVVTREEGL 157 Caenorhabditis elegans
7290608   73 SFYRKALGAILVYDITSRDSLVKL-ETWLAELDSYSDNPNIAIIVVGNKID-------------EE-----RVVDREEGR 133 fruit fly
15218575  80 SYYRGAQGIIMVYDVTRRDTFTNLsDIWAKEIDLYSTNQDCIKMLVGNKVD-------------KES---ERAVSKKEGI 143 thale cress
15232785  80 SYFRGSQGIILVYDVTKRETFLNLaDIWAKEIELYSTNHDCIKMLVGNKVD-------------RES---ERKVSREEGM 143 thale cress
12230528  76 SYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKID-------------KE----NREVDRNEGL 137 human
25151655 158 KFAKRHRTLFIEASAKTKEGVQCTFEELIEKIIQTPDLWD--NDRPSFRLG--QPTGSSGG--GGMCGC 220 Caenorhabditis elegans
7290608  134 KFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNg-NASAGLDIAs-DRDLEASA--S-TCYC 197 fruit fly
15218575 144 DFAREYGCLFLECSAKTRVNVEQCFEELVLKILETPSLTAegSSGGKKNIFkqNPAQTTSTssSYCCSS 212 thale cress
15232785 144 ALAKDLNCLFHECSARTRENVNGCFEELALKIMEVPSLLEegSSSVKR-----KPDYR--AhqGRCCSS 205 thale cress
12230528 138 KFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWEseNQNKGVKLSh-REEGQGGGacGGYCSV 205 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap