Conserved Protein Domain Family

KOG0048: KOG0048 
KOG0048, Transcription factor, Myb superfamily [Transcription]
PSSM-Id: 227999
Aligned: 136 rows
Threshold Bit Score: -1
Created: 20-Jun-2003
Updated: 16-Jan-2013
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
29427581   1 -MKER------QRWSGEEDALLRAYVRQFGPR------EWHLVSERMNkplNRDAKSCLERWKNYLKPGIK--------- 58   thale cress
15242835   1 ---mesrckkgyfrlaviglskakdcweknacavtfigdggtsegdfhaglnfaavmeapvvficrnngwaisthiseqf 77   thale cress
11358522 133 -------------KEAWTQEEELLLIRAHQIYGNR----WAELTKFLPGRSD---------------------------- 167  thale cress
25387535  77 -------------RGGWSPEEDMLLCEAQRVFGNR----WTEIAKVVSGRTD---------------------------- 111  thale cress
7446165   73 -------------RGGWSPEEDTLLCEAQRLFGNR----WTEIAKVVSGRTD---------------------------- 107  thale cress
29427581  59 -------------KGSLTEEEQRLVIRLQEKHGNK----WKKIAAEVPGRTA---------------------------- 93   thale cress
15225582 102 -------------RKPFSDEEEHMIMSAQAVLGNK----WSVIAKLLPGRTD---------------------------- 136  thale cress
15232609 107 -------------RNSFTEVEDQAIIAAHAIHGNK----WAVIAKLLPGRTD---------------------------- 141  thale cress
15228182 108 -------------RKPFSDEEDRMIISAHAVHGNK----WAVIAKLLTGRTD---------------------------- 142  thale cress
15242835  78 rsdgivvkgqaygirsirvdgndalavysavcsaremavteqrpvliemmiyrvghhstsddstkyraadeiqywkmsrn 157  thale cress
15240708  58 -------------HRPFSAEEDETIARAHAQFGNK----WATIARLLNGRTD---------------------------- 92   thale cress
18401769 168 kkkqvhnsdnepsSEILSRSNTCESFPDHGKSVVTvpdsEDVQDGHMPAASSsfpeaarafvdairrnrayqkflrgkla 247  thale cress
11358522 168 -NGI---KNHW---HSSV-------KKKLDSYMssglLDQYQAMPLAPYErsstlqstfm--qsnidgngcLNGQAENEI 231  thale cress
25387535 112 -NAV---KNRF---TTLC-------KKRAKHEAm---TKDS------------------------------------NSN 138  thale cress
7446165  108 -NAV---KNRF---TTLC-------KKRAKHEAm---AKENRIAC--CV----------------------------NSD 140  thale cress
29427581  94 -KRL---GKWWe--VFKE-------KQQREEKEsnkrVEPIDESKYDRILesfaeklv-----kersnvvpAAAAAATVV 155  thale cress
15225582 137 -NAI---KNHW---NSNL-------RRKPAEQWkiplLMSNTEIVYQLYP------------------------SMVRRI 178  thale cress
15232609 142 -NAI---KNHW---NSAL-------RRRFIDFEkaknIGTGSLVVDDSGF------------------------DRTTTV 183  thale cress
15228182 143 -NAI---KNHW---NSTL-------RRKYADLWnngqWMANSVTTASVKN------------------------ENVDET 184  thale cress
15242835 158 svnrfrksvedngwwseedesklrsnarkqllqaiqaaekwekqpltelfndvydvkpknleeeelglkeliekqpqdym 237  thale cress
15240708  93 -NAV---KNHW---NSTL-------KRKC---------GGYDHRGY----------------------------DGSED- 120  thale cress
18401769 248 eIEAtieQNEKhkkNVRIvkdfqasCKRITKLAlcqrKDPRVELISTRKSgpcdssevigpcdsfegndkkISPLTLGPA 327  thale cress
25387535 139 TKRMLFLDG-----------------------ISTPRKSENETPIAKKLKRSHILDLTEISNYG-----RAEACVNQQIR 190  thale cress
15225582 179 SN-ASPKEHLPQ---------------------EEETGVLSDDKMDDEAKEP--PREQN-----------SKTGVYRPVA 223  thale cress
15242835 238 mlkelipnwilgigtlalrydfqetlfngwhaiaelqqlklkiklnsllndqadteslkaarnsalnviqamIIHLVLTL 317  thale cress
15240708 121 HRPVKR-SVSAGS-----------------------PPVVTGLYMSPGSPTGSDVSDSSTIP------ILPSVELFKPVP 170  thale cress
11358522 312 SPSQdyqfdfqelsdisLEMRhnmseipmpytkeskestlgapnstlni------------------------------- 360  thale cress
25387535 191 SPFSvlarnatgidsleEQNQtsnvne----------------------------------------------------- 217  thale cress
7446165  198 HPFSvvahnatssdgteEQKQignvkesd--------------------------------------------------- 226  thale cress
29427581 236 GSMMpscsgssesvflsELVEccreleeghrawadhkkeaawrlrrlel------------------------------- 284  thale cress
15225582 224 RMGAfs---------vcKPgyma--------------------------------------------------------- 237  thale cress
15232609 264 HIQDqnqlqsskqdaamLRLLegayserfvpqtcgggccsnnpdgsfqq------------------------------- 312  thale cress
15228182 250 RVGAfs---------iyNPTSqkngyrdy--------------------------------------------------- 269  thale cress
15242835 318 KG-----------------Rfslp-------------------------------------------------------- 324  thale cress
15240708 171 RPG---------------AVVlplp------------------------------------------------------- 180  thale cress
18401769 408 QFLPkinwdsldikdrsAAECearwmssedplinhgpwtaaedknllrtieqtsltdwvdiavslgtnrtpfqclaryqr 487  thale cress
11358522 361 -------------------------dvatytnsanvltpeteccrvlfpdqeSEGHSVSRSLTQE 400  thale cress
25387535 218 -----------------------------------------------sdgegMFLKKDDPKVTAL 235  thale cress
7446165  227 --------------------------------------------gedksnqeVFLKKDDSKVTAL 247  thale cress
29427581 285 -------------------------qlesektcrqrekmeeieakmkalreeQKNAMEKIEGEYR 324  thale cress
15225582 238 ------------------------------------------------pcegPLVQASRPDSLAG 254  thale cress
15232609 313 -------------------------esllgpefvdyldsptfpsselaaiatEIGSLAWLRSGLE 352  thale cress
15228182 270 ---------------------------------------------nivpcegPLIQAAKPDSLAG 289  thale cress
15242835 325 -------------------------------------------------lteETVRFNEP--IQL 338  thale cress
15240708 181 -------------------------------------------------ietSSSSDDPPTSLSL 196  thale cress
18401769 488 slnpsilkkewtaeeddqlrtavelfgekdwqsvanvlkgrtgtqcsnrwkkSLRPTRKGTWSLE 552  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap