Conserved Protein Domain Family
COG5323

?
COG5323: COG5323 
Large terminase phage packaging protein [Mobilome: prophages, transposons]
Statistics
?
PSSM-Id: 227633
View PSSM: COG5323
Aligned: 4 rows
Threshold Bit Score: 101.18
Threshold Setting Gi: 20090659
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16127022 151 VEMMRALATVVMSLEPEDQQRLLSAALAEplihqlASPFSPWSTWLMLGGRGAGKTFAGARWITWNAL------AYPS-- 222 Caulobacter crescen...
15888291   1 MAEFLTETRLQGQVFNLLRDWRFIGNLPQ------QAPEGEWRTWLLIGGRGSGKTRAGAEWVHAVASa-----GKQSdl 69  Agrobacterium tumef...
17987633   6 RGKSWAVGLAFRQILAAQDEWLIRARDAQ------LPPDGDWRVWLIMGGRGSGKTRAGAEWVSGMALglppfaGKPSg- 78  Brucella melitensis
20090659     -------------------------------------------------------------------------------- Methanosarcina acet...
16127022 223 -QALIGPTLHDVREVMIEGPSGLKAMGGpAYRPRWEASRRRLVWPNGAVAYAFSAEDPESLRGPQFHAAWADEFCAWPKP 301 Caulobacter crescen...
15888291  70 rIALVAETLGDAREVMIDGISGICRIAR-RHRPAFEVSRRRLLWPNGAMAQVFSSEDPESLRGPQFHLAWSDELGKWKYP 148 Agrobacterium tumef...
17987633  79 hIALVGETFNDAREVMVDGPSGILSVSR-LVRPRYEASRRRLIWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNP 157 Brucella melitensis
20090659   1 -----------------------MYHAG--SYPYLKG--QMCDWVSG-----ES-ESPDRID-T---LVWTITELMGKEP 43  Methanosarcina acet...
16127022 302 AETLAMLRFGLRLGEDPRLVVTTTPKPHRALKTLMAEPGVALTRAGTSANAGNLAPAFLRTLASLYGGTRLAAQELDGVV 381 Caulobacter crescen...
15888291 149 QETWDMLQFGLRLGEMPRQLVTTTPRPIPLLKALLSDPTSRVARMPTAMNAQNLSPGFLKAMQERYGGTRLGRQEIGGEL 228 Agrobacterium tumef...
17987633 158 QETWDMLQFGLRLGDNPRQVVTTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIARRYAGTRLGRQELDGEL 237 Brucella melitensis
20090659  44 HVQAAMTWDGVGVVG-RFQNINNMKALIKT-------------------------------------------------- 72  Methanosarcina acet...
16127022 382 VET-DGGLFRAEDLARCRAARPARLDRVVVAVDPPATATGDA--CGIVVVGR-RDDRAFVLADETARGLSPAGWAGRAVA 457 Caulobacter crescen...
15888291 229 IDErEGALWKRADLEAIIEAAHEPLSRIVVAVDPPAGVGENSc-CGIVVAGLgMSGRLVVLADCSVEGETPAGWARAVVA 307 Agrobacterium tumef...
17987633 238 VEErPGALWSRDRIEQCFEENPPPLARIVVAVDPPASSGKASdaCGIVVAGIdAEGVGHVLADESMTMAKPHQWARRAIA 317 Brucella melitensis
20090659     -------------------------------------------------------------------------------- Methanosarcina acet...
16127022 458 AARAWTADALVAEANQGGDMVRSVLAQADPPCRVKLVRASLGKRARAEPVAALYEQGRVLHCGAFVALEEELMALGSGDL 537 Caulobacter crescen...
15888291 308 AFRRHEADRVVAEVNQGGEMVRAMLQSIDANLPLTLVRASRGKFTRAEPVAALYEQGRVRHSGRFEKLEDQMTDFGPDGL 387 Agrobacterium tumef...
17987633 318 LYHTHEADAIVAEVNQGGEMVAAVLAAEDPSVPVLKRRASRGKWLRAEPVAALYEQGRVRHAGRFPALEDEMCDFAPEGL 397 Brucella melitensis
20090659     -------------------------------------------------------------------------------- Methanosarcina acet...
16127022 538 EH--SPDRADALVWAVSELMLGEVRRPRLRAL 567 Caulobacter crescentus CB15
15888291 388 SSgrSPDRLDALVWAITALTTMVVNEPRVRGM 419 Agrobacterium tumefaciens str. C58 (Cereon)
17987633 398 SSgrSPDRLDALVWALGELMLGADHKPRIRRF 429 Brucella melitensis
20090659     -------------------------------- Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap