Conserved Protein Domain Family
GTPBP1

?
COG5258: GTPBP1 
GTPase [General function prediction only]
Statistics
?
PSSM-Id: 227583
View PSSM: COG5258
Aligned: 5 rows
Threshold Bit Score: 681.887
Threshold Setting Gi: 18312859
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350  44 IVEKILKLLERGEGE--NVEFKEFLGN-FHLKEGRFRQLACQMNHRIIMGKGVALYVVGVSDSGEIKGIDENKFSETIEV 120
gi 15679196   1 MIEDLRSFTSPGERR--NIEFKKALSArYHLKMDRKKGLISQMKYRMERGDGRAVYLLGVEDSGEPVGLPADKLDESVEV 78
gi 18312859   1 -----MFPPESEDGN---VEYKLTLGP----QD--VDRMAGQLKRRLAEGGGEAVYLIGVSNDGRPLGLPDEELVKALET 66
gi 15899178   1 ----MKLPRENDEGK---VEYKLILSS---VTPDRLQELATQMKYRLEEGDGEAFYVIGVSDEGEIIGLSKGQLEESIAT 70
gi 15790622   4 DRARLAAALERGEQEggSVEFKERFSRdIHLAEGRLESLTAQLRHRILSGDGEAEYVLGVTDDGGLAGVSQATFAETMDV 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350 121 LKKLATEIEAEVSSVERH---------EVNGGYVGLVEI---RKTK-AKEHILVGTAGHVDHGKSTLVGCLITGKPDDGD 187
gi 15679196  79 LRTLSSEIGAVVEEVNLH---------EGTEGMVAEVIIs--RKTKtAREHLLVGVAGHVDHGKSTLLGTLTTGTPDDGS 147
gi 18312859  67 LREMARRVGASLYILRVS---------EGIRGKVAEVLLr-aVSREePPPTVTVVALGNVDAGKSTLVGVLTTGRLDDGK 136
gi 15899178  71 LNMITRLVNAKIVYRRDVe--------VRRDKYVAELLVr--RYKEnLPVEVNVAVMGHVNAGKSTVTGALVLGRLDDGN 140
gi 15790622  84 LSLLADEAGAHIADVQTWgidsvgdapAGTDGIVGVATVqdgDGLAaGDDHIIVGTAGHVDHGKSTLVGSLVTGDADDGD 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350 188 GATRVYLDVLKHEIERGLSAEISFAVFGYKD-GKVL--RMKNPLSKAEKAMVVETADKLVSFVDTVGHEPWLRTTIRGLL 264
gi 15679196 148 GKTRIFLDVQKHEIERGLSADLSFAIYGFRD-GRPM--RLKNPLDRKEKSRLMDEADRVISFVDTVGHEPWLRTTIRGIV 224
gi 18312859 137 GLARSYASRYKHEVLTGRTSAVSLRLLGFSG-DKVVnhGLIDPLDEAEVY---KRSDKLVLLVDVGGHERYLRTALRGLF 212
gi 15899178 141 GGLRTAIARHLHEVLSGRTSSITLRVIGFDDsGKIVnwQLKDPLDEAETT--IKST-KIVRLIDLGGHERYLRTTLKGLL 217
gi 15790622 164 GATRGFLDVQPHEVERGLSADLSYGVYGFDG-DGPL--RVRNPDRKDERAAVVEAADRVVSFVDTVGHEPWLSTTIRGLV 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350 265 GQKVDYGLLVVAANDGVMRTTKEHLGIMLAMDLPVIVAVTKADMVDDARLSEVLQEISATLRR--VGRVPTVLKSRHDAR 342
gi 15679196 225 GQKLDYGLLTVAADEGPTHITREHLGIMIAMELPVIVVLTKCDMAADENRRGVREKISELLKL--VGRIPFHVKSLDAA- 301
gi 18312859 213 SSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMpgVSKIPYIIKDTNDVV 292
gi 15899178 218 GYEVNYVMLVVGADDGLSIMGKEHLALASVLKFPIFVVITKVDKYPEDRIKGIVNDIKSVLKIpgINRLALEVEDEDDVV 297
gi 15790622 241 GQKLDYGLLTVAADDGPTKTTREHMGVLLATELPTIVAVTKTDLVDDDRVAAVEREVEALLRR--TERAPLPVARHGVD- 317
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350 343 KAAEMVKSNKLLVPVVITSAVTLEGYDILEEIFLHLPKR--YTADED-FLMYIDKIYSVTGVGTVVSGSVKSGELAEGDE 419
gi 15679196 302 -AGIAGKMNQHIVPIIETSSVTGEGLEILDELFLNLRVRrdVNGDEEpFLMYIDKIYSIRGVGTVVSGTIQQGLVRKGDT 380
gi 18312859 293 LAAKAMPAGR-VAPVFYVSSVTGHGLDLLLRFLSLLPRRr-RWDYGGeFLMYISDIYLVKGVGVVIGGLVEKGILHVGDR 370
gi 15899178 298 NSILAIKTRR-VVPIFKISNVSGKGLDLLIKFLNLLPPEakNLDDRGaPLVYIDEIYNVTGVGTVVLGSVVRGKLNNNES 376
gi 15790622 318 --AAVDELGDGVVPIVRTSAVTGDGLAVLDELFARLPKT--T-AASGpFRMYVDRTYSVTGVGAVASGTVKSGTVEDGET 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498350 420 VYIGPFQDGSFRRVRIQSIEMHHYRIDRAKAGDIIGAAVKGVRYDELRRGMVISR--KEPRAVWEFDAEIYVFTHPTLIS 497
gi 15679196 381 LLLGPLKTGKFREVTVKSIEMHHYRIGCAEPGHIVGISISGASPDEIERGMILAHpdYDPEAVREFEAEVAILVHPTTIK 460
gi 18312859 371 VWLGPYSDGKWMQTVVKSIHFNRTPVESAKAGSFITVALDKVEK--VEKGMVLSAr--PLKAVREVTADVLVLRHPTVIR 446
gi 15899178 377 VLIGPNKLGEFKEVKIKSIQVNKVFVDSVLAGNIATFAIQGIEKESLRKGMVMVKg--IPKVVRRFKARVFILHHPTTIR 454
gi 15790622 393 LLLGPFPNGSFRTVEVRSIEMHYHRVDSAQAGRIVGIALKGVSEEAIERGMVLLPgdADPTPVRAFDAEVMVLNHPTRID 472
                       490       500       510       520       530       540
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 11498350 498 VGYEPVMHVETISETVTFVEMDKEYLKPGDRGIVRMKFKYHPHFVYEGQKFIFREGRSKGMGEIIRVF 565
gi 15679196 461 AGYESVTHIETIAETTVLEPLDSDFMSAGDRGRVRMRFKYRPHHVREGQKIIFREGRSKGIGSVTRIL 528
gi 18312859 447 AGFSGVFHYKAVRTGGYIKEIDKGELMVGDSGVVKIELS-RPWHIDSG-VFVFRNGPTRILGRIIGTD 512
gi 15899178 455 EGYVATLHSYTIRQAVKFEKIQTGFLRTGDTSEIVLYFLYRPEYLEKGQIFVFREGRTRGVGIVLEPI 522
gi 15790622 473 AGYEPVVHLETIGEAARFTPADGQLL-PGDAGHTRVRFKFRPYLVEEGQRFVFREGSSKGVGTVTDVV 539
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap