Conserved Protein Domain Family
GCD11

?
COG5257: GCD11 
Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 227582
View PSSM: COG5257
Aligned: 16 rows
Threshold Bit Score: 665.581
Threshold Setting Gi: 18311686
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494301   11 SPIHPAIis-----------rQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKCSNeecp 79
gi 3122252    2 RRNPSTFkyiplridfmsevpLPEVNIGLVGHVDHGKTTLVAALSGVWTDRHSEELKRGISIKLGYADATFRKCPE---- 77
gi 7674079    8 SGGDKR---------------QPEVNIGVVGHVDHGKTTLVQALTGVWTMRHSEEIRRGMTIKLGYADGEVWECEG---- 68
gi 20092490  23 ISDYLHStggn------ynlsQPCVNIGMVGHVDHGKTTLVKALSGVWTDTHSEEVKRGISIRLGYADSPFMKCPK---- 92
gi 3122251    1 MKNQS------------------EINIGLVGHVDHGKTTLTKALSGVWTDTHSEETKRGISIRLGYADITFRKCPQ---- 58
gi 18311686   1 MAFVY-----------------PDAIVSTAGHVDHGKTQTTYALSGVWVMRHSEEIKKAMTIKLGYTQIGIYDCGE---- 59
gi 15897345   1 MAWPKV---------------QPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCES---- 61
gi 13542105   2 ISKLKMP--------------QPTVNIGMVGHVDHGKSTLTLALTGVKTDTHSEEIKRGISIKLGYADTPVYKCYD---- 63
gi 13878555   2 ISKLKMP--------------QPSVNIGMVGHVDHGKSTLTLALTGTKTDTHSEEIKRGISIKLGYADTPIYRCYD---- 63
gi 20532138   1 MAD-EHR--------------QPEVNIGLVGHVDHGKTTLVRALSGEWTDQHSEEMKRGISIRLGYADATLRRCPD---- 61
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494301   80 rpgCYRSysSNKEDHPPCEICNSPm--NLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAI 157
gi 3122252   78 ---CEPP--EAYTVEEICPIHGVEt--EILRTVSFVDSPGHEMLMATMLSGAAIMDGAVLVIAANEKCPRPQTKEHLMAL 150
gi 7674079   69 ---CGFP--ERFSPEPVCE-CDPQasaSLRRRVSYVDAPGHEILMATMLSGAALMDGALLVVAANEPCPQPQTKEHLVAL 142
gi 20092490  93 ---CPAP--QCYTVEKTCPNCGEKt--EEHRIVSFVDAPGHETLMATMLSGAAIMDGAVLVIAANEECPQPQTKEHLMAL 165
gi 3122251   59 ---CEAP--MCYTTAEICERCGTEt--ELLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMAL 131
gi 18311686  60 ---EYYYs-DGILQNGKCP-NGAEp--KLIRRISLLDVPGHEVLVATMVSGAAVVDGALLVVDASQPAPQPQTVEHFAVL 132
gi 15897345  62 ---CKKP--EAYVTEPSCKSCGSDdepKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVAL 136
gi 13542105  64 ---ASG---NPYYTRQPSENC------ELERVISIVDAPGHETLMATMLSGSALMNGALLVIAANEHCPQPQTREHLTAL 131
gi 13878555  64 ---SSG---NVHYTREKGENC------DLERVISIVDAPGHETLMATMLSGSALMNGALLVIAANEHCPQPQTREHLTAL 131
gi 20532138  62 ---CDEP--ECYTVAETCPEHDTAt--EIERTVSFVDAPGHETLMATMLSGAALMDGAVLVVGANEPVPQPQTEEHLMAL 134
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494301  158 EIMQLKHIIILQNKVDLIRESAAEEHYQSILKFIKGTVAENSPIVPISAQLKYNIDAILEYIVKKIPIPVRDFTTAPRLI 237
gi 3122252  151 QIIGIDKIVIAQNKIDIVSRERVLENYQEIKEFVKGTVAENAPIIPISAQQKVNMDALIEAIEETIPTPERDLDSPPLMH 230
gi 7674079  143 EIIGIKNIVIVQNKVDVVSRERAKESYQEILNFIKGTIAEGSPIIPVSALKRANIDAVLAAIEKFIPTPPRDLDKPPVMY 222
gi 20092490 166 DIIGIKNIVIVQNKIDLVSREKLVENYHQIKEFVKGTVAENAPIIPISAQQNINIDVLIDALETQIPTPVHKVDKPASML 245
gi 3122251  132 DVIGVKDVIVVQNKIDIVSKERALESYREIKEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERIKTPKRDVDKPARMY 211
gi 18311686 133 DIIGVRHMVVAQNKIDLVTKEKALENYEQIKNFLKGTWAEKAKVVPISALHRVNIDALVTYLAKEIPKREAELGKPALFS 212
gi 15897345 137 GIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVML 216
gi 13542105 132 EIMGIKNIVIVQNKIDLVTRERALESYKEIKAFVKGSIAENAPIIPVSAYHNTNIDILFEAIEKYIPTPEYNEGSDPIMY 211
gi 13878555 132 EIMGIKNIIIVQNKIDLVTRERAIESYREIKNFVKGSIAENAPIIPVSAYHSTNIDALFEAIEKYIPSPKFNENDDPIMY 211
gi 20532138 135 DIIGIENIVIAQNKVDLVDAEEARQNYEEIQAFVEGTVAEDAPVVPVSAEQEINVDLVIDALQTEIATPDRDPSADPLLY 214
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494301  238 VIRSFDVNKPGAEVDDLKGGVAGGSILTGVLRLNDEIEIRPGIVTKDDDgRIRCQPIFSRIISLFAEHNDLKIAVPGGLI 317
gi 3122252  231 VARSFDVNKPGTPPEKLLGGVLGGSLSRGRIRVGDEIEIRPGV---KDE-RGNWNPLFTEVQSIVASGRFVDEATPGGLV 306
gi 7674079  223 ISRSFDVNRPGTPPERLVGGVVGGSIIQGVFRVGDEIEISPGVAVRKPGgRVEYVRLHTTITSLRFGSIEVEEARPGGLV 302
gi 20092490 246 IARSFDINKPGASIDEIRGGVIGGTLTEGVLHPGDELEIRPGIKVTTEG-STKWIPIVTTISSIYAGPTKVEEATPGGLL 324
gi 3122251  212 VARSFDINKPGADPEHLAGGVIGGSLVQGRLRVGDEIEIRPGIQVKKDG-KQTWMSLHSTITGLVAGGEEMEEVGPGGLV 290
gi 18311686 213 VLRSFNVNPPGTAPDKLRGGVLGGTLLRGVLRVGDEIELRPGLKVDKPK--PGYQPIYTKVLSIEYSGQKVEEARPGGLV 290
gi 15897345 217 VIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQG-KVSYEPIFTKISSIRFGDEEFKEAKPGGLV 295
gi 13542105 212 IARSFDVNKPGTPIDQIKGGIIGGSLTQGSLKIGDEIEIVPGIQNTRGN-KTVWTNVTTEVVSLMAGKYSYDMIKPGGLA 290
gi 13878555 212 IARSFDINRPGTPVSELKGGVIGGSLTQGEFALGDEIEIVPGIQTTKGN-KTVWNNVTTEVVSLMAGKYSYDRIRPGGLA 290
gi 20532138 215 AARSFDINRPGTEWGGLLGGVIGGSLVDGELEAGDELELRPGREVEEGG-KTEWRPVTTDVRSLQAGGEDVDSASPGGLL 293
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2494301  318 GVGTTVDPTLCRADRLVGQVLGSKGNLPEVYTELEINYFLLRRLLGVKsgdkNTTKVQKLAKNEVLMVNIGSTSTGGRVM 397
gi 3122252  307 GIATKLDPTLTKSDALVGNVVGHPGNLPDVLTSFTMEVNLLERVVGLD----EEMEVEKIKMNEPLMLAVGTAITLGVVT 382
gi 7674079  303 AIGTQLDPSVTKADNLVGNVVGKPGELPEPLTTLRIEHHLLEKVVGMK----EEARVEPIRRGEMLMLSVGTAITLGVVT 378
gi 20092490 325 AVGTYLDPTLTKGDSLTGQIAGVPGTLPETRHQFVMELHLLDRVVGVT----REEKINEIKTSEPLMLNIGTATTVGIVT 400
gi 3122251  291 GVGTLLDPALTKADSLSGSVAGEPGTLPPVRHSFTMETHLLERVVGTK----EETKVEPIKTGEPLMINVGTTTTVGVVK 366
gi 18311686 291 GIMTGLDPALTKADALAGAVVGKPGTLPPVWTAVEVETRPIPRALA--------EKIEPFKQNEVVLLAVGPATVFGVVQ 362
gi 15897345 296 AIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAK----EMLKVDPIRAKETLMLSVGSSTTLGIVT 371
gi 13542105 291 AVGTKLDPFLTKGDAFTGRIAGYIGKVPPISFSMRLEAHLLKRVVGSD----QELNVEPIRAKETLMFTVATANTVGVVS 366
gi 13878555 291 AIGTKLDPFLTKGDAFTGRIAGHVGKVPPVAFSMRLESHLLKRVVGSD----QELNVEPIRPKETLMFTVATANTVGVVN 366
gi 20532138 294 GVGTGLDPSLTKGDALAGQVAGPPGSLPPTWESFEMDVDLLERLVGAA----DGEQIDDISTGEPLMLTVGTATTVGSVT 369
                       410       420       430       440
                ....*....|....*....|....*....|....*....|....*.
gi 2494301  398 MVKADMAKILLTAPACTEI-GEKVALSRRIEKHWRLIGWAKVVEGK 442
gi 3122252  383 SARDDIVEVKLRRPVCADK-GSRVAISRRVGSRWRLIGAGIIR--- 424
gi 7674079  379 RAGKDEIEVQLRRPVVTWP-KARVALSRRIMGRWRLIGWGLIK--- 420
gi 20092490 401 SARKNEAQVALKRPISAAV-GAMVAISRRIDSRWRLIGVGVIKS-- 443
gi 3122251  367 SARADDADVVLKLPACAEE-GQRIALSRRVGARWRLIGYGIIK--- 408
gi 18311686 363 AVKKDAITVALKKAVCAEQ-GSKVVVIRQVKNRWIVTNYGTLKGGT 407
gi 15897345 372 SVKKDEIEVELRRPVAVWSnNIRTVISRQIAGRWRMIGWGLVEI-- 415
gi 13542105 367 NVKGTDIEVSLKYPVAAFN-GMRVAIGRRVLNRWRLIGYGVIESLE 411
gi 13878555 367 AMKGSEIEVSLKYPVAAFN-GMRVAIGRRVMNRWRLIGYGIIQSLE 411
gi 20532138 370 SARDGECEVALKRPVCAPA-GAKIAINRRVGARWRLIGVGTLTESE 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap